• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
    • SZDB
  • DNA & RNA Element
    • UTRdb
    • circBase
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
    • InWeb_IM
  • Disease
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosSNP
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
UUCD2 ID IUUC-Bta-012956
UUCD1 version UUC-BoT-00945
Ensembl Protein ID ENSBTAP00000019215.3
UniProt Accession Q3SWY5; NOSIP_BOVIN
Genbank Protein ID AAI04601.1
Protein Name Nitric oxide synthase-interacting protein; E3 ubiquitin-protein ligase NOSIP; RING-type E3 ubiquitin transferase NOSIP
Genbank Nucleotide ID BC104600
Gene Name NOSIP
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSBTAG00000014450.3 ENSBTAT00000019215.3 ENSBTAP00000019215.3
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/RING/U-box 6.00e-16 58.4 40 79
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/RING/U-box

   S: 2    vpeeflCpIslelMrdPvvlpsGitydrssIekwlasggk 41
    v ++ +C +sl++ +dPvv+p+G+ y+r++I +++ +++k
   Q: 40 VKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKK 79
    567789*****************************98887 PP
   

Organism Bos taurus
Functional Description
(View)

Functional Description



     E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face. Catalyzes monoubiquitination of serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB (By similarity). Negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity (By similarity).
E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face. Catalyzes monoubiquitination of serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB (By similarity). Negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity (By similarity).
Protein Sequence
(Fasta)
MTRHGKNCTA GAVYTYHEKK KDTAASGYGT QNIRLSRDAV KDFDCCCLSL QPCHDPVVTP 60
DGYLYEREAI LEYILHQKKE IARQMKAYEK QRGARREEQK ELQRAAAQDH VRGFLEKEAA 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bta-012956|E3,U-box|Bos taurus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CGGAGAGGGA AAACAGCGCT CCTTTCCGGT GTAGGGGTAC TGTTGAAGTA GCCACCGAGG 60
AAAGAGGGTC GTCTGTGAGG TGAGTTCTAG GCGGTAGAAG AATAGTGTTA GTGCGATTGC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bta-012956|E3,U-box|Bos taurus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0217--Developmental protein
KW-0539--Nucleus
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR016818--Nitric_oxide_synth-interacting
IPR031790--Znf-NOSIP
IPR013083--Znf_RING/FYVE/PHD

Pfam

PF15906--zf-NOSIP

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005634--C:nucleus
GO:0003723--F:RNA binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0007275--P:multicellular organism development
GO:0051001--P:negative regulation of nitric-oxide synthase activity
GO:0016567--P:protein ubiquitination

KEGG bta:511234
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000769 Aegilops tauschii 46.51 1.00e-16 81.30
IUUC-Aml-002069 Ailuropoda melanoleuca 92.68 1.00e-166 578.00
IUUC-Atr-002661 Amborella trichopoda 31.96 9.00e-31 127.00
IUUC-Aca-004630 Anolis carolinensis 75.17 4.00e-136 477.00
IUUC-Aly-006316 Arabidopsis lyrata 30.49 6.00e-30 124.00
IUUC-Ath-007000 Arabidopsis thaliana 30.16 1.00e-29 123.00
IUUC-Acl-008175 Aspergillus clavatus 31.97 9.00e-06 44.70
IUUC-Afl-008440 Aspergillus flavus 33.91 1.00e-05 43.90
IUUC-Afu-009012 Aspergillus fumigatus 33.06 2.00e-06 46.60
IUUC-Ani-009153 Aspergillus nidulans 33.33 4.00e-03 35.80
IUUC-Ang-009556 Aspergillus niger 34.78 6.00e-06 45.10
IUUC-Aor-009892 Aspergillus oryzae 33.91 1.00e-05 44.30
IUUC-Ame-011874 Astyanax mexicanus 64.61 4.00e-110 390.00
IUUC-Bgr-012090 Blumeria graminis 26.28 2.00e-05 43.50
IUUC-Bci-013897 Botrytis cinerea 42.50 8.00e-10 57.80
IUUC-Bdi-014968 Brachypodium distachyon 30.17 4.00e-34 138.00
IUUC-Bol-015578 Brassica oleracea 30.82 2.00e-34 139.00
IUUC-Bra-017234 Brassica rapa 30.82 2.00e-34 139.00
IUUC-Cel-018637 Caenorhabditis elegans 41.23 2.00e-57 215.00
IUUC-Cja-019632 Callithrix jacchus 94.04 8.00e-169 585.00
IUUC-Cfa-020192 Canis familiaris 95.36 9.00e-170 589.00
IUUC-Cpo-021939 Cavia porcellus 90.73 7.00e-155 539.00
IUUC-Cre-023005 Chlamydomonas reinhardtii 34.65 6.00e-43 167.00
IUUC-Csa-023802 Chlorocebus sabaeus 94.37 7.00e-169 586.00
IUUC-Cho-024637 Choloepus hoffmanni 77.98 1.00e-82 298.00
IUUC-Cin-025180 Ciona intestinalis 51.82 3.00e-85 308.00
IUUC-Csv-026206 Ciona savignyi 47.09 5.00e-44 170.00
IUUC-Cgl-026696 Colletotrichum gloeosporioides 26.85 6.00e-13 68.20
IUUC-Cne-026827 Cryptococcus neoformans 36.36 1.00e-06 47.40
IUUC-Dre-028092 Danio rerio 65.46 2.00e-117 415.00
IUUC-Dno-029501 Dasypus novemcinctus 89.11 2.00e-143 502.00
IUUC-Dor-030542 Dipodomys ordii 90.79 2.00e-161 560.00
IUUC-Dse-031188 Dothistroma septosporum 25.00 2.00e-15 77.00
IUUC-Dme-031734 Drosophila melanogaster 49.19 1.00e-78 286.00
IUUC-Eca-033577 Equus caballus 97.02 8.00e-174 602.00
IUUC-Fca-035761 Felis catus 96.36 3.00e-172 597.00
IUUC-Fox-037703 Fusarium oxysporum 27.33 6.00e-08 51.60
IUUC-Fso-038208 Fusarium solani 26.11 4.00e-13 68.60
IUUC-Gmo-038523 Gadus morhua 60.62 6.00e-61 226.00
IUUC-Ggr-040087 Gaeumannomyces graminis 41.03 7.00e-10 58.20
IUUC-Gac-042621 Gasterosteus aculeatus 60.38 2.00e-109 388.00
IUUC-Gma-042698 Glycine max 30.93 1.00e-32 133.00
IUUC-Ggo-045357 Gorilla gorilla 94.37 5.00e-169 586.00
IUUC-Hsa-046195 Homo sapiens 94.37 5.00e-169 586.00
IUUC-Hvu-047174 Hordeum vulgare 30.51 4.00e-35 141.00
IUUC-Itr-048487 Ictidomys tridecemlineatus 92.05 8.00e-162 562.00
IUUC-Lch-050569 Latimeria chalumnae 68.27 5.00e-117 413.00
IUUC-Lpe-050992 Leersia perrieri 35.15 3.00e-23 102.00
IUUC-Loc-052522 Lepisosteus oculatus 69.21 5.00e-117 413.00
IUUC-Lma-053254 Leptosphaeria maculans 39.24 1.00e-09 57.40
IUUC-Laf-053397 Loxodonta africana 95.39 4.00e-169 586.00
IUUC-Mcc-054681 Macaca mulatta 94.37 4.00e-169 587.00
IUUC-Meu-056723 Macropus eugenii 83.55 1.00e-150 525.00
IUUC-Mor-056961 Magnaporthe oryzae 37.27 4.00e-10 59.30
IUUC-Mpo-057359 Magnaporthe poae 25.84 2.00e-06 46.20
IUUC-Mtr-058063 Medicago truncatula 31.85 3.00e-34 138.00
IUUC-Mla-059004 Melampsora laricipopulina 30.03 1.00e-25 110.00
IUUC-Mvi-060460 Microbotryum violaceum 29.50 1.00e-24 106.00
IUUC-Mmr-060847 Microcebus murinus 96.69 1.00e-172 598.00
IUUC-Mdo-062480 Monodelphis domestica 84.54 2.00e-152 531.00
IUUC-Mmu-063809 Mus musculus 92.05 1.00e-163 568.00
IUUC-Mac-064870 Musa acuminata 31.27 6.00e-34 137.00
IUUC-Mpu-066322 Mustela putorius furo 97.04 6.00e-173 599.00
IUUC-Mlu-067556 Myotis lucifugus 93.42 5.00e-158 550.00
IUUC-Ncr-068898 Neurospora crassa 38.46 1.00e-07 51.20
IUUC-Nle-070049 Nomascus leucogenys 94.70 2.00e-169 587.00
IUUC-Opr-070972 Ochotona princeps 89.87 6.00e-158 549.00
IUUC-Ont-071682 Oreochromis niloticus 66.67 4.00e-116 410.00
IUUC-Oan-073296 Ornithorhynchus anatinus 98.31 2.00e-32 131.00
IUUC-Ocu-074218 Oryctolagus cuniculus 88.97 1.00e-131 462.00
IUUC-Oba-075284 Oryza barthii 31.62 4.00e-34 138.00
IUUC-Obr-076651 Oryza brachyantha 31.62 7.00e-37 147.00
IUUC-Ogl-077899 Oryza glaberrima 31.62 4.00e-34 138.00
IUUC-Ogu-078477 Oryza glumaepatula 31.96 3.00e-34 138.00
IUUC-Oin-080011 Oryza indica 31.62 4.00e-34 138.00
IUUC-Olo-080545 Oryza longistaminata 31.13 5.00e-27 115.00
IUUC-Ome-081543 Oryza meridionalis 31.62 4.00e-34 138.00
IUUC-Oni-082955 Oryza nivara 31.62 4.00e-34 138.00
IUUC-Opu-083565 Oryza punctata 31.62 3.00e-34 139.00
IUUC-Oru-084474 Oryza rufipogon 31.62 4.00e-34 138.00
IUUC-Osa-085913 Oryza sativa 31.62 4.00e-34 138.00
IUUC-Ola-086851 Oryzias latipes 66.89 4.00e-119 420.00
IUUC-Olu-087724 Ostreococcus lucimarinus 33.01 4.00e-12 65.10
IUUC-Oga-087970 Otolemur garnettii 95.38 5.00e-170 589.00
IUUC-Oar-089756 Ovis aries 96.37 2.00e-168 584.00
IUUC-Ptr-091485 Pan troglodytes 93.38 2.00e-165 574.00
IUUC-Pan-091832 Papio anubis 94.70 2.00e-169 587.00
IUUC-Pma-094551 Petromyzon marinus 63.52 3.00e-109 387.00
IUUC-Pno-094830 Phaeosphaeria nodorum 26.72 1.00e-08 53.90
IUUC-Ppa-095255 Physcomitrella patens 30.56 1.00e-31 130.00
IUUC-Pfo-096373 Poecilia formosa 65.03 4.00e-117 414.00
IUUC-Pab-098247 Pongo abelii 94.37 5.00e-169 586.00
IUUC-Pop-099186 Populus trichocarpa 30.93 5.00e-31 127.00
IUUC-Pca-100677 Procavia capensis 91.30 2.00e-138 484.00
IUUC-Ppe-101403 Prunus persica 30.14 1.00e-31 130.00
IUUC-Pva-103000 Pteropus vampyrus 96.03 4.00e-172 596.00
IUUC-Pgr-103663 Puccinia graminis 30.15 2.00e-29 123.00
IUUC-Ptt-103712 Puccinia triticina 40.00 5.00e-09 54.70
IUUC-Pte-104287 Pyrenophora teres 26.86 2.00e-16 80.10
IUUC-Pyt-104579 Pyrenophora triticirepentis 26.22 2.00e-13 69.70
IUUC-Rno-106069 Rattus norvegicus 92.38 3.00e-164 570.00
IUUC-Sha-106553 Sarcophilus harrisii 83.55 4.00e-151 526.00
IUUC-Smo-108874 Selaginella moellendorffii 32.24 6.00e-38 150.00
IUUC-Sit-110307 Setaria italica 31.62 1.00e-33 136.00
IUUC-Sly-111094 Solanum lycopersicum 32.08 6.00e-33 134.00
IUUC-Stu-112363 Solanum tuberosum 32.88 1.00e-32 133.00
IUUC-Sar-113480 Sorex araneus 94.70 3.00e-158 550.00
IUUC-Sbi-113939 Sorghum bicolor 31.62 3.00e-34 138.00
IUUC-Ssc-115644 Sus scrofa 97.68 9.00e-175 605.00
IUUC-Tru-118781 Takifugu rubripes 66.12 4.00e-121 427.00
IUUC-Tni-119672 Tetraodon nigroviridis 74.71 6.00e-35 138.00
IUUC-Tca-121795 Theobroma cacao 31.62 2.00e-35 142.00
IUUC-Tre-122037 Trichoderma reesei 36.36 2.00e-08 53.10
IUUC-Tvi-122524 Trichoderma virens 26.80 8.00e-17 81.30
IUUC-Tae-122828 Triticum aestivum 30.85 3.00e-35 142.00
IUUC-Tur-126387 Triticum urartu 30.74 2.00e-28 120.00
IUUC-Tme-127111 Tuber melanosporum 40.00 1.00e-09 57.40
IUUC-Ttr-128227 Tursiops truncatus 97.02 1.00e-172 598.00
IUUC-Vda-129924 Verticillium dahliae 27.27 5.00e-15 75.10
IUUC-Vpa-130802 Vicugna pacos 96.63 7.00e-45 173.00
IUUC-Vvi-131105 Vitis vinifera 32.30 7.00e-34 137.00
IUUC-Xtr-132830 Xenopus tropicalis 65.31 4.00e-122 431.00
IUUC-Xma-133618 Xiphophorus maculatus 65.79 8.00e-112 396.00
IUUC-Zma-135389 Zea mays 31.27 2.00e-33 135.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved