• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • GWASdb
  • PTM
    • dbPAF
    • PhosphositePlus
    • dbPTM
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
UUCD2 ID IUUC-Ogl-077099
UUCD1 version UUC-OrG-02363
Ensembl Protein ID ORGLA03G0416800.1
UniProt Accession I1Q0Z4; I1Q0Z4_ORYGL
Protein Name Defective in cullin neddylation protein
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ORGLA03G0416800 ORGLA03G0416800.1 ORGLA03G0416800.1
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/DCUN1 7.40e-84 281.2 54 240
UBD/Alpha-Helix/UBA 6.50e-07 29.9 10 46
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/DCUN1

   S: 2    skkkleelferYkdpqedligieglekfcedlgvdpediavLvlawkleaatlcefsreefldgltalgcdsieklqeklktleselkdeqk 93
    ++++le+l++rYk+p+ d+i +eg+++fc dl+vdp+di++Lv++w+++aat+cef+r+ef+ gl+++g+dsiekl+ekl++l+ e+kd +k
   Q: 54 NSRHLEDLYNRYKEPDVDMIMVEGVSQFCTDLQVDPQDIVMLVISWHMKAATMCEFTRQEFIGGLQSIGVDSIEKLREKLPSLRAEIKDDHK 145
    5799**************************************************************************************** PP
   S: 94 fkdiYrfafnfakdkgqksldldtaialwkLllaerefklldawlkfLeeekkksiskDtWnllLefskviakdlsnYdeegaWPvliDefv 185
    f++iY+faf +a++kgqksl l+ta+ +w+Ll+aer+++l+d+w++fL+ +++k+is+DtW +lLef k+i+++lsnYdeegaWP+liDefv
   Q: 146 FREIYNFAFAWAREKGQKSLGLETALGMWQLLFAERHWPLIDHWCQFLQVRHNKAISRDTWSQLLEFVKTIDPQLSNYDEEGAWPYLIDEFV 237
    ******************************************************************************************** PP
   S: 186 eyl 188
    eyl
   Q: 238 EYL 240
    *96 PP
   


   UBD/Alpha-Helix/UBA

   S: 5    dkleqlve.MGFdreealqaLraannnleaAveyLld 40
    dk++q++ +G +++ alqaL a++++le A +++++
   Q: 10 DKVQQFMTiTGASEKVALQALKASDWHLEGAFDFFYS 46
    89*******************************9987 PP
   

Organism Oryza glaberrima
Functional Description
(View)

Functional Description



     Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Protein Sequence
(Fasta)
MHKLGRGSRD KVQQFMTITG ASEKVALQAL KASDWHLEGA FDFFYSQPQI SLTNSRHLED 60
LYNRYKEPDV DMIMVEGVSQ FCTDLQVDPQ DIVMLVISWH MKAATMCEFT RQEFIGGLQS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ogl-077099|E3,DCUN1;UBD,UBA|Oryza glaberrima
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGTTAGTA CCTCACCTCG CCCCCCGTCT CGATTCCGCG TCTCTTCGCG ATTCGTTTCG 60
ACCCATTTGT GATTTTTTTT TTCTGGGGGT TGTGTGTGTT TGAAATCGGT GTGCGTGCGA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ogl-077099|E3,DCUN1;UBD,UBA|Oryza glaberrima
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR014764--DCN-prot
IPR005176--PONY_dom
IPR009060--UBA-like

PROSITE

PS51229--DCUN1

Pfam

PF03556--Cullin_binding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000561 Aegilops tauschii 92.00 2.00e-138 483.00
IUUC-Aml-001879 Ailuropoda melanoleuca 44.31 7.00e-62 229.00
IUUC-Atr-002697 Amborella trichopoda 78.38 1.00e-52 197.00
IUUC-Apl-003933 Anas platyrhynchos 45.53 4.00e-62 229.00
IUUC-Aca-005269 Anolis carolinensis 44.53 1.00e-61 228.00
IUUC-Aly-006285 Arabidopsis lyrata 65.18 2.00e-92 330.00
IUUC-Ath-007531 Arabidopsis thaliana 71.49 2.00e-108 384.00
IUUC-Ago-007806 Ashbya gossypii 24.18 9.00e-19 85.90
IUUC-Acl-008172 Aspergillus clavatus 28.35 1.00e-28 119.00
IUUC-Afl-008569 Aspergillus flavus 32.39 2.00e-35 141.00
IUUC-Afu-009005 Aspergillus fumigatus 29.51 2.00e-21 94.70
IUUC-Ani-009241 Aspergillus nidulans 24.66 6.00e-24 103.00
IUUC-Ang-009664 Aspergillus niger 30.58 8.00e-31 126.00
IUUC-Aor-009902 Aspergillus oryzae 27.91 6.00e-12 62.00
IUUC-Ate-010414 Aspergillus terreus 29.96 5.00e-33 133.00
IUUC-Ame-011763 Astyanax mexicanus 45.93 4.00e-63 233.00
IUUC-Bgr-011991 Blumeria graminis 31.46 5.00e-23 100.00
IUUC-Bta-012373 Bos taurus 44.44 2.00e-57 214.00
IUUC-Bci-013824 Botrytis cinerea 33.47 5.00e-32 130.00
IUUC-Bdi-014138 Brachypodium distachyon 90.40 6.00e-137 478.00
IUUC-Bol-016110 Brassica oleracea 71.77 9.00e-108 381.00
IUUC-Bra-017111 Brassica rapa 71.37 3.00e-108 383.00
IUUC-Cel-018441 Caenorhabditis elegans 32.61 7.00e-41 159.00
IUUC-Cja-018854 Callithrix jacchus 46.75 3.00e-62 230.00
IUUC-Cfa-020523 Canis familiaris 43.97 1.00e-57 214.00
IUUC-Cpo-021832 Cavia porcellus 45.97 8.00e-62 229.00
IUUC-Cre-022620 Chlamydomonas reinhardtii 48.02 4.00e-68 250.00
IUUC-Csa-023551 Chlorocebus sabaeus 44.53 2.00e-62 231.00
IUUC-Cho-024373 Choloepus hoffmanni 43.90 3.00e-58 217.00
IUUC-Cin-025269 Ciona intestinalis 45.75 2.00e-63 234.00
IUUC-Csv-025976 Ciona savignyi 36.77 2.00e-35 141.00
IUUC-Cgl-026386 Colletotrichum gloeosporioides 30.00 2.00e-21 94.70
IUUC-Cne-026950 Cryptococcus neoformans 34.48 7.00e-38 149.00
IUUC-Cme-027199 Cyanidioschyzon merolae 29.45 2.00e-08 52.00
IUUC-Dre-028247 Danio rerio 45.93 4.00e-63 233.00
IUUC-Dno-028974 Dasypus novemcinctus 44.53 2.00e-62 231.00
IUUC-Dor-030143 Dipodomys ordii 46.75 1.00e-62 231.00
IUUC-Dse-031365 Dothistroma septosporum 25.91 4.00e-25 107.00
IUUC-Dme-032197 Drosophila melanogaster 42.15 7.00e-57 213.00
IUUC-Ete-032371 Echinops telfairi 44.31 6.00e-62 229.00
IUUC-Eca-033242 Equus caballus 44.31 7.00e-62 229.00
IUUC-Eeu-035317 Erinaceus europaeus 44.72 3.00e-62 230.00
IUUC-Fca-036061 Felis catus 44.13 4.00e-62 230.00
IUUC-Fal-036715 Ficedula albicollis 45.53 3.00e-62 230.00
IUUC-Fox-037884 Fusarium oxysporum 32.68 3.00e-17 80.50
IUUC-Fso-038150 Fusarium solani 30.92 4.00e-21 94.40
IUUC-Gmo-038885 Gadus morhua 45.53 1.00e-63 235.00
IUUC-Ggr-039959 Gaeumannomyces graminis 27.75 7.00e-17 81.30
IUUC-Gga-040935 Gallus gallus 44.13 5.00e-62 229.00
IUUC-Gac-041478 Gasterosteus aculeatus 45.93 3.00e-62 230.00
IUUC-Gma-043545 Glycine max 76.61 5.00e-120 422.00
IUUC-Ggo-044972 Gorilla gorilla 46.56 2.00e-62 231.00
IUUC-Hsa-046994 Homo sapiens 46.96 8.00e-63 232.00
IUUC-Hvu-047636 Hordeum vulgare 37.60 3.00e-21 93.60
IUUC-Itr-047902 Ictidomys tridecemlineatus 46.75 2.00e-62 231.00
IUUC-Kpa-049127 Komagataella pastoris 29.08 6.00e-29 120.00
IUUC-Lch-050600 Latimeria chalumnae 46.56 2.00e-64 237.00
IUUC-Lpe-051540 Leersia perrieri 98.39 8.00e-148 514.00
IUUC-Loc-052509 Lepisosteus oculatus 45.75 7.00e-63 232.00
IUUC-Lma-053103 Leptosphaeria maculans 29.03 8.00e-29 119.00
IUUC-Laf-053972 Loxodonta africana 47.56 2.00e-63 234.00
IUUC-Mcc-054700 Macaca mulatta 46.56 1.00e-62 231.00
IUUC-Meu-056791 Macropus eugenii 41.63 3.00e-47 181.00
IUUC-Mor-056909 Magnaporthe oryzae 29.23 8.00e-25 106.00
IUUC-Mpo-057299 Magnaporthe poae 27.51 1.00e-20 92.80
IUUC-Mtr-057964 Medicago truncatula 74.19 1.00e-116 411.00
IUUC-Mla-058990 Melampsora laricipopulina 27.24 7.00e-19 87.00
IUUC-Mga-060072 Meleagris gallopavo 45.93 2.00e-62 231.00
IUUC-Mvi-060312 Microbotryum violaceum 35.86 1.00e-41 162.00
IUUC-Mmr-060851 Microcebus murinus 44.31 9.00e-62 229.00
IUUC-Mdo-063074 Monodelphis domestica 44.31 4.00e-61 229.00
IUUC-Mmu-063816 Mus musculus 46.15 2.00e-63 234.00
IUUC-Mac-065016 Musa acuminata 81.67 2.00e-91 326.00
IUUC-Mpu-066870 Mustela putorius furo 43.97 1.00e-57 214.00
IUUC-Mlu-067701 Myotis lucifugus 43.90 7.00e-61 226.00
IUUC-Nfi-068610 Neosartorya fischeri 29.51 1.00e-21 95.50
IUUC-Ncr-068780 Neurospora crassa 23.53 5.00e-18 84.00
IUUC-Nle-069475 Nomascus leucogenys 46.56 2.00e-62 231.00
IUUC-Opr-070682 Ochotona princeps 44.15 4.00e-46 177.00
IUUC-Ont-071813 Oreochromis niloticus 46.75 4.00e-63 233.00
IUUC-Oan-073031 Ornithorhynchus anatinus 44.72 4.00e-62 230.00
IUUC-Ocu-074648 Oryctolagus cuniculus 44.31 7.00e-62 229.00
IUUC-Oba-074993 Oryza barthii 100.00 3.00e-150 522.00
IUUC-Obr-076341 Oryza brachyantha 96.00 1.00e-145 507.00
IUUC-Ogu-078285 Oryza glumaepatula 98.80 4.00e-148 516.00
IUUC-Oin-079441 Oryza indica 99.60 1.00e-149 521.00
IUUC-Olo-081037 Oryza longistaminata 99.60 1.00e-149 521.00
IUUC-Ome-081357 Oryza meridionalis 99.60 1.00e-149 521.00
IUUC-Oni-082632 Oryza nivara 99.20 5.00e-149 518.00
IUUC-Opu-083351 Oryza punctata 98.72 1.00e-139 487.00
IUUC-Oru-084306 Oryza rufipogon 99.60 1.00e-149 521.00
IUUC-Osa-085307 Oryza sativa 99.60 1.00e-149 521.00
IUUC-Ola-086371 Oryzias latipes 46.34 3.00e-63 233.00
IUUC-Olu-087646 Ostreococcus lucimarinus 40.65 9.00e-51 192.00
IUUC-Oga-088621 Otolemur garnettii 45.12 2.00e-61 227.00
IUUC-Oar-090405 Ovis aries 43.90 3.00e-61 227.00
IUUC-Ptr-090735 Pan troglodytes 44.31 7.00e-62 229.00
IUUC-Pan-092825 Papio anubis 46.56 1.00e-62 232.00
IUUC-Psi-093110 Pelodiscus sinensis 43.53 1.00e-56 211.00
IUUC-Pma-094196 Petromyzon marinus 40.86 2.00e-44 172.00
IUUC-Pno-095145 Phaeosphaeria nodorum 29.80 2.00e-24 105.00
IUUC-Ppa-095321 Physcomitrella patens 75.20 2.00e-113 400.00
IUUC-Pfo-097121 Poecilia formosa 45.12 7.00e-63 233.00
IUUC-Pab-098197 Pongo abelii 45.69 8.00e-57 212.00
IUUC-Pop-098821 Populus trichocarpa 78.57 3.00e-54 202.00
IUUC-Pca-100218 Procavia capensis 43.50 2.00e-61 227.00
IUUC-Ppe-102032 Prunus persica 75.81 4.00e-119 419.00
IUUC-Pva-102691 Pteropus vampyrus 46.96 5.00e-63 233.00
IUUC-Pgr-103633 Puccinia graminis 27.14 5.00e-23 100.00
IUUC-Ptt-103979 Puccinia triticina 34.29 8.00e-05 40.40
IUUC-Pyt-104428 Pyrenophora triticirepentis 29.05 3.00e-25 107.00
IUUC-Rno-105016 Rattus norvegicus 46.56 1.00e-63 235.00
IUUC-Sce-106358 Saccharomyces cerevisiae 24.23 4.00e-20 90.50
IUUC-Sha-106542 Sarcophilus harrisii 45.75 5.00e-62 229.00
IUUC-Sja-107938 Schizosaccharomyces japonicus 28.87 2.00e-23 101.00
IUUC-Spo-108207 Schizosaccharomyces pombe 34.50 2.00e-27 114.00
IUUC-Ssl-108410 Sclerotinia sclerotiorum 33.20 3.00e-33 134.00
IUUC-Smo-108750 Selaginella moellendorffii 65.29 5.00e-92 329.00
IUUC-Sit-110613 Setaria italica 90.80 6.00e-139 485.00
IUUC-Sly-111489 Solanum lycopersicum 77.02 1.00e-119 421.00
IUUC-Stu-112517 Solanum tuberosum 62.45 9.00e-97 345.00
IUUC-Sar-113509 Sorex araneus 43.60 2.00e-41 161.00
IUUC-Sbi-114082 Sorghum bicolor 88.80 2.00e-136 476.00
IUUC-Sre-115221 Sporisorium reilianum 27.53 2.00e-26 111.00
IUUC-Ssc-115547 Sus scrofa 44.53 2.00e-62 231.00
IUUC-Tgu-117196 Taeniopygia guttata 45.93 3.00e-62 230.00
IUUC-Tru-117740 Takifugu rubripes 44.90 7.00e-62 229.00
IUUC-Tsy-119599 Tarsius syrichta 44.31 7.00e-62 229.00
IUUC-Tni-120542 Tetraodon nigroviridis 46.03 1.00e-60 225.00
IUUC-Tca-121033 Theobroma cacao 77.02 4.00e-121 426.00
IUUC-Tre-121986 Trichoderma reesei 25.25 8.00e-21 93.60
IUUC-Tvi-122607 Trichoderma virens 31.10 3.00e-26 111.00
IUUC-Tae-125740 Triticum aestivum 79.04 6.00e-133 465.00
IUUC-Tur-126375 Triticum urartu 71.56 6.00e-128 449.00
IUUC-Tme-126878 Tuber melanosporum 34.17 3.00e-37 148.00
IUUC-Tbe-127429 Tupaia belangeri 42.93 2.00e-46 178.00
IUUC-Ttr-129086 Tursiops truncatus 40.24 9.00e-53 199.00
IUUC-Uma-129364 Ustilago maydis 29.10 2.00e-33 135.00
IUUC-Vda-129929 Verticillium dahliae 30.89 6.00e-21 94.40
IUUC-Vpa-130048 Vicugna pacos 38.21 3.00e-48 184.00
IUUC-Vvi-130834 Vitis vinifera 78.23 7.00e-121 425.00
IUUC-Xtr-131888 Xenopus tropicalis 44.31 3.00e-62 230.00
IUUC-Xma-133580 Xiphophorus maculatus 46.56 2.00e-63 234.00
IUUC-Yli-134595 Yarrowia lipolytica 33.61 5.00e-38 149.00
IUUC-Zma-135642 Zea mays 89.20 7.00e-138 481.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved