• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Fca-035447
Ensembl Protein ID ENSFCAP00000016674.1
UniProt Accession M3WQP3; M3WQP3_FELCA
Genbank Protein ID ENSFCAP00000016674
Protein Name Uncharacterized protein
Genbank Nucleotide ID AANG02094651
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSFCAG00000023401.1 ENSFCAT00000025360.1 ENSFCAP00000016674.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 9.80e-19 67.0 13 47
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGnp+++g+CSkC+ree++++r
   Q: 13 DQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKAR 47
    79*******************************86 PP
   

Organism Felis catus
Protein Sequence
(Fasta)
MSLKSERRGI HVDQSELLCK KGCGYYGNPA WQGFCSKCWR EEYHKARQKQ IQEDWELAER 60
LQREEEEAFA SSQSSQGAQS LTFSKFEKKT NEKTRKVTTV KKFFSASSRV GSKKEIQEAK 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Fca-035447|UBD,ZnF_A20|Felis catus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
AAAGAAGATG AGCCTGAAGT CTGAACGCCG TGGAATTCAC GTGGATCAGT CGGAGCTCCT 60
ATGCAAGAAA GGATGTGGTT ACTATGGCAA CCCTGCTTGG CAGGGTTTCT GCTCCAAGTG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Fca-035447|UBD,ZnF_A20|Felis catus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0005730--C:nucleolus
GO:0003677--F:DNA binding
GO:0017112--F:Rab guanyl-nucleotide exchange factor activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0006612--P:protein targeting to membrane
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 32.26 3.00e-20 93.20
IUUC-Aml-001771 Ailuropoda melanoleuca 88.92 0.00e+00 757.00
IUUC-Atr-003154 Amborella trichopoda 36.52 6.00e-23 101.00
IUUC-Apl-004018 Anas platyrhynchos 89.02 0.00e+00 838.00
IUUC-Aca-005227 Anolis carolinensis 23.47 1.00e-09 58.50
IUUC-Aly-006138 Arabidopsis lyrata 35.45 7.00e-25 108.00
IUUC-Ath-006747 Arabidopsis thaliana 34.92 1.00e-24 107.00
IUUC-Ago-007776 Ashbya gossypii 29.05 3.00e-23 102.00
IUUC-Acl-008235 Aspergillus clavatus 31.45 1.00e-29 124.00
IUUC-Afl-008570 Aspergillus flavus 32.21 4.00e-32 133.00
IUUC-Afu-008815 Aspergillus fumigatus 31.23 3.00e-30 126.00
IUUC-Ani-009381 Aspergillus nidulans 30.74 2.00e-30 127.00
IUUC-Ang-009615 Aspergillus niger 30.90 3.00e-32 133.00
IUUC-Aor-010195 Aspergillus oryzae 32.21 8.00e-33 134.00
IUUC-Ate-010514 Aspergillus terreus 31.80 8.00e-31 128.00
IUUC-Ame-011365 Astyanax mexicanus 66.53 0.00e+00 668.00
IUUC-Bgr-012102 Blumeria graminis 29.07 1.00e-30 128.00
IUUC-Bta-013124 Bos taurus 95.11 0.00e+00 885.00
IUUC-Bci-013943 Botrytis cinerea 30.85 8.00e-31 129.00
IUUC-Bdi-014539 Brachypodium distachyon 34.70 5.00e-26 112.00
IUUC-Bol-016580 Brassica oleracea 35.14 8.00e-30 124.00
IUUC-Bra-017843 Brassica rapa 34.68 1.00e-29 124.00
IUUC-Cel-018199 Caenorhabditis elegans 34.36 1.00e-58 220.00
IUUC-Cja-019941 Callithrix jacchus 93.69 0.00e+00 872.00
IUUC-Cfa-020845 Canis familiaris 95.43 0.00e+00 816.00
IUUC-Cpo-022037 Cavia porcellus 93.08 0.00e+00 864.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 31.82 1.00e-20 94.70
IUUC-Csa-023272 Chlorocebus sabaeus 92.87 0.00e+00 866.00
IUUC-Cho-025076 Choloepus hoffmanni 82.48 0.00e+00 738.00
IUUC-Cin-025400 Ciona intestinalis 44.31 6.00e-113 400.00
IUUC-Csv-025941 Ciona savignyi 37.70 3.00e-87 315.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 28.72 6.00e-27 115.00
IUUC-Cne-027057 Cryptococcus neoformans 32.09 4.00e-35 142.00
IUUC-Dre-028484 Danio rerio 70.30 0.00e+00 674.00
IUUC-Dno-028906 Dasypus novemcinctus 93.70 0.00e+00 861.00
IUUC-Dor-030124 Dipodomys ordii 83.27 0.00e+00 744.00
IUUC-Dse-031437 Dothistroma septosporum 28.67 9.00e-27 115.00
IUUC-Dme-031696 Drosophila melanogaster 33.26 4.00e-68 252.00
IUUC-Ete-032573 Echinops telfairi 91.73 0.00e+00 715.00
IUUC-Eca-033711 Equus caballus 95.11 0.00e+00 886.00
IUUC-Eeu-034459 Erinaceus europaeus 73.79 8.00e-79 288.00
IUUC-Fal-036605 Ficedula albicollis 85.63 0.00e+00 777.00
IUUC-Fox-037967 Fusarium oxysporum 25.99 3.00e-17 83.60
IUUC-Fso-038110 Fusarium solani 29.33 8.00e-29 122.00
IUUC-Gmo-038785 Gadus morhua 66.40 0.00e+00 667.00
IUUC-Ggr-039760 Gaeumannomyces graminis 29.96 5.00e-26 112.00
IUUC-Gga-040584 Gallus gallus 89.63 0.00e+00 842.00
IUUC-Gac-042469 Gasterosteus aculeatus 63.78 2.00e-164 572.00
IUUC-Gma-044237 Glycine max 37.43 4.00e-26 112.00
IUUC-Ggo-044498 Gorilla gorilla 79.67 0.00e+00 719.00
IUUC-Hsa-046625 Homo sapiens 93.69 0.00e+00 872.00
IUUC-Hvu-047155 Hordeum vulgare 38.20 3.00e-26 112.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 94.91 0.00e+00 866.00
IUUC-Kpa-049160 Komagataella pastoris 29.73 1.00e-24 108.00
IUUC-Lch-050529 Latimeria chalumnae 78.50 0.00e+00 847.00
IUUC-Lpe-051024 Leersia perrieri 35.16 2.00e-28 120.00
IUUC-Loc-052644 Lepisosteus oculatus 68.34 0.00e+00 659.00
IUUC-Lma-053102 Leptosphaeria maculans 30.65 6.00e-28 119.00
IUUC-Laf-054337 Loxodonta africana 92.26 0.00e+00 867.00
IUUC-Mcc-055659 Macaca mulatta 92.01 2.00e-175 608.00
IUUC-Meu-056084 Macropus eugenii 76.47 4.00e-94 338.00
IUUC-Mor-057255 Magnaporthe oryzae 29.24 1.00e-26 115.00
IUUC-Mpo-057454 Magnaporthe poae 29.96 8.00e-28 118.00
IUUC-Mtr-058098 Medicago truncatula 35.00 1.00e-30 127.00
IUUC-Mla-059068 Melampsora laricipopulina 30.14 3.00e-31 129.00
IUUC-Mga-059624 Meleagris gallopavo 76.43 0.00e+00 832.00
IUUC-Mvi-060282 Microbotryum violaceum 49.11 5.00e-21 96.70
IUUC-Mmr-061142 Microcebus murinus 94.30 0.00e+00 884.00
IUUC-Mdo-062289 Monodelphis domestica 93.08 0.00e+00 892.00
IUUC-Mmu-063961 Mus musculus 93.08 0.00e+00 866.00
IUUC-Mac-065188 Musa acuminata 36.31 2.00e-22 100.00
IUUC-Mpu-066291 Mustela putorius furo 94.31 0.00e+00 879.00
IUUC-Mlu-067431 Myotis lucifugus 90.24 0.00e+00 837.00
IUUC-Nfi-068422 Neosartorya fischeri 31.10 5.00e-31 129.00
IUUC-Ncr-068843 Neurospora crassa 30.25 2.00e-29 124.00
IUUC-Nle-069079 Nomascus leucogenys 93.48 0.00e+00 869.00
IUUC-Opr-070790 Ochotona princeps 94.44 6.00e-57 215.00
IUUC-Ont-071789 Oreochromis niloticus 67.30 1.00e-175 608.00
IUUC-Oan-072946 Ornithorhynchus anatinus 86.82 0.00e+00 805.00
IUUC-Ocu-073816 Oryctolagus cuniculus 94.31 0.00e+00 872.00
IUUC-Oba-075738 Oryza barthii 33.71 8.00e-18 85.10
IUUC-Obr-076355 Oryza brachyantha 38.33 3.00e-27 116.00
IUUC-Ogl-077217 Oryza glaberrima 37.16 2.00e-24 107.00
IUUC-Ogu-078197 Oryza glumaepatula 28.35 9.00e-27 114.00
IUUC-Oin-080047 Oryza indica 38.20 5.00e-26 112.00
IUUC-Olo-080317 Oryza longistaminata 28.35 1.00e-26 113.00
IUUC-Ome-081589 Oryza meridionalis 37.64 8.00e-26 112.00
IUUC-Oni-082700 Oryza nivara 33.71 6.00e-18 85.10
IUUC-Opu-083923 Oryza punctata 34.36 3.00e-21 95.50
IUUC-Oru-084318 Oryza rufipogon 33.71 6.00e-18 85.10
IUUC-Osa-086246 Oryza sativa 38.98 6.00e-06 41.60
IUUC-Ola-086730 Oryzias latipes 53.15 7.00e-148 517.00
IUUC-Olu-087719 Ostreococcus lucimarinus 34.46 9.00e-24 104.00
IUUC-Oga-088992 Otolemur garnettii 82.39 0.00e+00 877.00
IUUC-Oar-089789 Ovis aries 94.52 0.00e+00 875.00
IUUC-Ptr-091636 Pan troglodytes 93.69 0.00e+00 870.00
IUUC-Pan-092911 Papio anubis 93.08 0.00e+00 868.00
IUUC-Psi-093194 Pelodiscus sinensis 76.87 0.00e+00 832.00
IUUC-Pma-094212 Petromyzon marinus 48.09 1.00e-113 402.00
IUUC-Pno-094831 Phaeosphaeria nodorum 30.25 3.00e-28 120.00
IUUC-Ppa-095705 Physcomitrella patens 33.86 5.00e-29 122.00
IUUC-Pfo-096694 Poecilia formosa 62.25 1.00e-178 619.00
IUUC-Pab-097706 Pongo abelii 93.48 0.00e+00 870.00
IUUC-Pop-099891 Populus trichocarpa 32.84 3.00e-26 112.00
IUUC-Pca-100879 Procavia capensis 87.32 4.00e-91 327.00
IUUC-Ppe-101334 Prunus persica 33.48 3.00e-26 112.00
IUUC-Pva-103225 Pteropus vampyrus 78.99 0.00e+00 708.00
IUUC-Pgr-103564 Puccinia graminis 30.38 4.00e-31 129.00
IUUC-Ptt-103802 Puccinia triticina 29.80 5.00e-26 112.00
IUUC-Pte-104345 Pyrenophora teres 29.52 4.00e-28 119.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 30.60 1.00e-28 121.00
IUUC-Rno-106101 Rattus norvegicus 92.87 0.00e+00 867.00
IUUC-Sce-106460 Saccharomyces cerevisiae 30.77 4.00e-25 109.00
IUUC-Sha-106919 Sarcophilus harrisii 78.80 0.00e+00 840.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 32.52 1.00e-30 127.00
IUUC-Spo-108087 Schizosaccharomyces pombe 30.23 8.00e-28 118.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 24.89 7.00e-07 49.30
IUUC-Smo-109411 Selaginella moellendorffii 37.14 8.00e-29 121.00
IUUC-Sit-110678 Setaria italica 37.64 4.00e-26 112.00
IUUC-Sly-111526 Solanum lycopersicum 37.85 1.00e-25 110.00
IUUC-Stu-112494 Solanum tuberosum 36.93 3.00e-26 112.00
IUUC-Sar-112929 Sorex araneus 98.55 1.00e-163 570.00
IUUC-Sbi-114242 Sorghum bicolor 32.55 1.00e-27 117.00
IUUC-Sre-115224 Sporisorium reilianum 31.43 9.00e-30 125.00
IUUC-Ssc-115239 Sus scrofa 94.72 0.00e+00 880.00
IUUC-Tgu-117499 Taeniopygia guttata 87.37 0.00e+00 820.00
IUUC-Tru-118450 Takifugu rubripes 57.89 8.00e-167 580.00
IUUC-Tsy-119462 Tarsius syrichta 93.91 0.00e+00 854.00
IUUC-Tni-120855 Tetraodon nigroviridis 63.15 3.00e-172 598.00
IUUC-Tca-121213 Theobroma cacao 35.45 4.00e-25 108.00
IUUC-Tre-122186 Trichoderma reesei 29.51 7.00e-28 118.00
IUUC-Tvi-122541 Trichoderma virens 27.40 2.00e-28 120.00
IUUC-Tae-123631 Triticum aestivum 34.51 5.00e-27 115.00
IUUC-Tur-126572 Triticum urartu 39.33 2.00e-26 113.00
IUUC-Tme-127023 Tuber melanosporum 32.93 3.00e-32 133.00
IUUC-Tbe-127453 Tupaia belangeri 97.40 0.00e+00 776.00
IUUC-Ttr-128526 Tursiops truncatus 94.70 0.00e+00 882.00
IUUC-Uma-129660 Ustilago maydis 31.78 5.00e-30 126.00
IUUC-Vda-129737 Verticillium dahliae 29.49 4.00e-24 106.00
IUUC-Vpa-130505 Vicugna pacos 91.43 0.00e+00 716.00
IUUC-Vvi-131088 Vitis vinifera 37.08 4.00e-24 105.00
IUUC-Xtr-132799 Xenopus tropicalis 77.85 0.00e+00 745.00
IUUC-Xma-133345 Xiphophorus maculatus 62.87 2.00e-174 605.00
IUUC-Yli-134416 Yarrowia lipolytica 32.85 2.00e-32 133.00
IUUC-Zma-134750 Zea mays 38.20 5.00e-26 112.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved