• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
UUCD2 ID IUUC-Mlu-067431
UUCD1 version UUC-MyL-00035
Ensembl Protein ID ENSMLUP00000000550.2
UniProt Accession G1NTP5; G1NTP5_MYOLU
Genbank Protein ID ENSMLUP00000000550
Protein Name Uncharacterized protein
Genbank Nucleotide ID AAPE02016539
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMLUG00000000605.2 ENSMLUT00000000608.2 ENSMLUP00000000550.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 9.90e-19 67.1 25 59
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGnp+++g+CSkC+ree++++r
   Q: 25 DQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKAR 59
    79*******************************86 PP
   

Organism Myotis lucifugus
Protein Sequence
(Fasta)
HFLVCYLINR KKMSLKSERR GIHVDQSELL CKKGCGYYGN PAWQGFCSKC WREEYHKARQ 60
KQIQEDWELA ERLQREEEEA FASSQTSQGA QSLTFSKFEE KKTNEKTRKV TTVKKFFSAS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mlu-067431|UBD,ZnF_A20|Myotis lucifugus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CACTTTCTTG TTTGTTATTT GATTAACAGG AAGAAAATGA GCCTTAAGTC TGAACGCCGA 60
GGAATTCACG TGGATCAATC AGAGCTCCTT TGCAAGAAAG GATGTGGTTA CTACGGCAAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mlu-067431|UBD,ZnF_A20|Myotis lucifugus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0005730--C:nucleolus
GO:0003677--F:DNA binding
GO:0017112--F:Rab guanyl-nucleotide exchange factor activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0006612--P:protein targeting to membrane
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 32.88 2.00e-21 97.10
IUUC-Aml-001771 Ailuropoda melanoleuca 83.25 0.00e+00 710.00
IUUC-Atr-003154 Amborella trichopoda 37.29 2.00e-23 103.00
IUUC-Apl-004018 Anas platyrhynchos 88.24 0.00e+00 820.00
IUUC-Aca-005227 Anolis carolinensis 23.08 4.00e-09 57.00
IUUC-Aly-006138 Arabidopsis lyrata 35.45 1.00e-24 107.00
IUUC-Ath-006747 Arabidopsis thaliana 34.92 3.00e-24 106.00
IUUC-Ago-007776 Ashbya gossypii 28.87 1.00e-23 103.00
IUUC-Acl-008235 Aspergillus clavatus 37.99 1.00e-26 115.00
IUUC-Afl-008570 Aspergillus flavus 39.38 3.00e-29 123.00
IUUC-Afu-008815 Aspergillus fumigatus 37.99 5.00e-27 116.00
IUUC-Ani-009381 Aspergillus nidulans 37.50 2.00e-27 117.00
IUUC-Ang-009615 Aspergillus niger 33.64 6.00e-29 122.00
IUUC-Aor-010195 Aspergillus oryzae 39.38 1.00e-29 124.00
IUUC-Ate-010514 Aspergillus terreus 39.11 4.00e-28 119.00
IUUC-Ame-011365 Astyanax mexicanus 64.43 0.00e+00 643.00
IUUC-Bgr-012102 Blumeria graminis 28.17 2.00e-27 117.00
IUUC-Bta-013124 Bos taurus 93.50 0.00e+00 843.00
IUUC-Bci-013943 Botrytis cinerea 40.99 1.00e-27 118.00
IUUC-Bdi-014539 Brachypodium distachyon 34.84 7.00e-27 115.00
IUUC-Bol-016580 Brassica oleracea 37.57 4.00e-29 122.00
IUUC-Bra-017843 Brassica rapa 37.04 8.00e-29 121.00
IUUC-Cel-018199 Caenorhabditis elegans 34.36 5.00e-58 218.00
IUUC-Cja-019941 Callithrix jacchus 91.97 0.00e+00 839.00
IUUC-Cfa-020845 Canis familiaris 93.26 0.00e+00 776.00
IUUC-Cpo-022037 Cavia porcellus 91.67 0.00e+00 823.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 32.99 5.00e-22 99.00
IUUC-Csa-023495 Chlorocebus sabaeus 92.12 0.00e+00 839.00
IUUC-Cho-025076 Choloepus hoffmanni 81.10 0.00e+00 691.00
IUUC-Cin-025400 Ciona intestinalis 43.76 2.00e-111 395.00
IUUC-Csv-025941 Ciona savignyi 38.10 3.00e-84 305.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 37.89 3.00e-25 110.00
IUUC-Cne-027057 Cryptococcus neoformans 36.90 5.00e-31 129.00
IUUC-Dre-028484 Danio rerio 68.58 0.00e+00 645.00
IUUC-Dno-028906 Dasypus novemcinctus 93.09 0.00e+00 831.00
IUUC-Dor-030124 Dipodomys ordii 81.67 0.00e+00 699.00
IUUC-Dse-031437 Dothistroma septosporum 26.76 7.00e-24 105.00
IUUC-Dme-031696 Drosophila melanogaster 32.78 8.00e-69 254.00
IUUC-Ete-032573 Echinops telfairi 86.67 0.00e+00 671.00
IUUC-Eca-033711 Equus caballus 93.90 0.00e+00 855.00
IUUC-Eeu-034459 Erinaceus europaeus 97.73 2.00e-73 270.00
IUUC-Fca-035447 Felis catus 92.28 0.00e+00 852.00
IUUC-Fal-036605 Ficedula albicollis 84.60 0.00e+00 760.00
IUUC-Fox-037967 Fusarium oxysporum 48.68 3.00e-17 84.00
IUUC-Fso-038110 Fusarium solani 29.07 2.00e-27 117.00
IUUC-Gmo-038785 Gadus morhua 64.89 0.00e+00 649.00
IUUC-Ggr-039760 Gaeumannomyces graminis 39.35 8.00e-27 115.00
IUUC-Gga-040584 Gallus gallus 88.82 0.00e+00 830.00
IUUC-Gac-042469 Gasterosteus aculeatus 62.98 2.00e-162 565.00
IUUC-Gma-044237 Glycine max 37.43 3.00e-26 113.00
IUUC-Ggo-044498 Gorilla gorilla 79.67 0.00e+00 690.00
IUUC-Hsa-046625 Homo sapiens 91.97 0.00e+00 840.00
IUUC-Hvu-047155 Hordeum vulgare 38.89 4.00e-27 115.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 91.87 0.00e+00 833.00
IUUC-Kpa-049160 Komagataella pastoris 31.73 3.00e-22 99.80
IUUC-Lch-050529 Latimeria chalumnae 76.82 0.00e+00 832.00
IUUC-Lpe-051024 Leersia perrieri 34.84 5.00e-29 122.00
IUUC-Loc-052644 Lepisosteus oculatus 68.34 0.00e+00 647.00
IUUC-Lma-053102 Leptosphaeria maculans 35.50 9.00e-25 108.00
IUUC-Laf-054337 Loxodonta africana 90.45 0.00e+00 837.00
IUUC-Mcc-055659 Macaca mulatta 90.91 3.00e-164 571.00
IUUC-Meu-056084 Macropus eugenii 74.66 1.00e-91 330.00
IUUC-Mor-057255 Magnaporthe oryzae 37.42 5.00e-25 109.00
IUUC-Mpo-057454 Magnaporthe poae 39.35 2.00e-27 117.00
IUUC-Mtr-058098 Medicago truncatula 37.17 2.00e-29 123.00
IUUC-Mla-059068 Melampsora laricipopulina 35.87 6.00e-30 125.00
IUUC-Mga-059624 Meleagris gallopavo 75.60 0.00e+00 818.00
IUUC-Mvi-060282 Microbotryum violaceum 30.86 1.00e-23 105.00
IUUC-Mmr-061142 Microcebus murinus 92.38 0.00e+00 869.00
IUUC-Mdo-062289 Monodelphis domestica 88.82 0.00e+00 850.00
IUUC-Mmu-063961 Mus musculus 91.46 0.00e+00 823.00
IUUC-Mac-065188 Musa acuminata 36.87 7.00e-23 101.00
IUUC-Mpu-066291 Mustela putorius furo 91.87 0.00e+00 854.00
IUUC-Nfi-068422 Neosartorya fischeri 37.31 5.00e-28 119.00
IUUC-Ncr-068843 Neurospora crassa 37.65 3.00e-27 117.00
IUUC-Nle-069079 Nomascus leucogenys 91.87 0.00e+00 827.00
IUUC-Opr-070790 Ochotona princeps 92.59 4.00e-55 209.00
IUUC-Ont-071789 Oreochromis niloticus 66.74 5.00e-171 593.00
IUUC-Oan-072946 Ornithorhynchus anatinus 86.61 0.00e+00 790.00
IUUC-Ocu-073816 Oryctolagus cuniculus 93.12 0.00e+00 844.00
IUUC-Oba-075738 Oryza barthii 33.33 9.00e-18 84.70
IUUC-Obr-076355 Oryza brachyantha 38.46 9.00e-28 117.00
IUUC-Ogl-077592 Oryza glaberrima 34.92 3.00e-27 115.00
IUUC-Ogu-078197 Oryza glumaepatula 34.92 4.00e-27 115.00
IUUC-Oin-080047 Oryza indica 37.78 5.00e-26 112.00
IUUC-Olo-080317 Oryza longistaminata 34.92 6.00e-27 114.00
IUUC-Ome-081589 Oryza meridionalis 37.78 2.00e-26 114.00
IUUC-Oni-082700 Oryza nivara 33.33 8.00e-18 85.10
IUUC-Opu-083923 Oryza punctata 34.97 5.00e-22 98.20
IUUC-Oru-084318 Oryza rufipogon 33.33 8.00e-18 85.10
IUUC-Osa-086246 Oryza sativa 40.68 1.00e-06 43.90
IUUC-Ola-086730 Oryzias latipes 56.63 8.00e-146 510.00
IUUC-Olu-087719 Ostreococcus lucimarinus 34.64 1.00e-23 103.00
IUUC-Oga-088992 Otolemur garnettii 80.28 0.00e+00 866.00
IUUC-Oar-089789 Ovis aries 92.84 0.00e+00 857.00
IUUC-Ptr-091636 Pan troglodytes 92.48 0.00e+00 831.00
IUUC-Pan-092911 Papio anubis 91.27 0.00e+00 845.00
IUUC-Psi-093194 Pelodiscus sinensis 76.82 0.00e+00 826.00
IUUC-Pma-094212 Petromyzon marinus 46.59 6.00e-109 387.00
IUUC-Pno-094831 Phaeosphaeria nodorum 33.33 2.00e-25 111.00
IUUC-Ppa-095705 Physcomitrella patens 34.92 2.00e-29 124.00
IUUC-Pfo-096694 Poecilia formosa 63.12 1.00e-170 592.00
IUUC-Pab-097706 Pongo abelii 92.14 0.00e+00 835.00
IUUC-Pop-099891 Populus trichocarpa 37.43 7.00e-26 112.00
IUUC-Pca-100879 Procavia capensis 84.11 2.00e-84 305.00
IUUC-Ppe-101334 Prunus persica 35.45 5.00e-26 112.00
IUUC-Pva-103225 Pteropus vampyrus 77.82 0.00e+00 668.00
IUUC-Pgr-103564 Puccinia graminis 30.57 2.00e-29 124.00
IUUC-Ptt-103802 Puccinia triticina 45.13 5.00e-24 105.00
IUUC-Pte-104345 Pyrenophora teres 34.50 2.00e-25 110.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 34.30 3.00e-26 114.00
IUUC-Rno-106101 Rattus norvegicus 90.96 0.00e+00 830.00
IUUC-Sce-106460 Saccharomyces cerevisiae 30.38 5.00e-24 105.00
IUUC-Sha-106919 Sarcophilus harrisii 76.57 0.00e+00 808.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 37.57 5.00e-29 122.00
IUUC-Spo-108087 Schizosaccharomyces pombe 32.46 9.00e-26 111.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 29.82 2.00e-07 51.20
IUUC-Smo-108740 Selaginella moellendorffii 37.14 2.00e-28 120.00
IUUC-Sit-110678 Setaria italica 35.64 4.00e-27 115.00
IUUC-Sly-111526 Solanum lycopersicum 38.98 3.00e-26 112.00
IUUC-Stu-112494 Solanum tuberosum 39.55 8.00e-27 115.00
IUUC-Sar-112929 Sorex araneus 97.45 3.00e-162 565.00
IUUC-Sbi-114242 Sorghum bicolor 36.65 1.00e-27 117.00
IUUC-Sre-115224 Sporisorium reilianum 36.84 2.00e-27 117.00
IUUC-Ssc-115239 Sus scrofa 93.90 0.00e+00 850.00
IUUC-Tgu-117499 Taeniopygia guttata 85.98 0.00e+00 798.00
IUUC-Tru-118450 Takifugu rubripes 56.39 7.00e-165 573.00
IUUC-Tsy-119462 Tarsius syrichta 92.24 0.00e+00 830.00
IUUC-Tni-120855 Tetraodon nigroviridis 58.57 3.00e-167 581.00
IUUC-Tca-121213 Theobroma cacao 35.45 6.00e-25 108.00
IUUC-Tre-122186 Trichoderma reesei 37.10 5.00e-27 115.00
IUUC-Tvi-122541 Trichoderma virens 33.48 2.00e-27 117.00
IUUC-Tae-123631 Triticum aestivum 40.00 1.00e-27 117.00
IUUC-Tur-126572 Triticum urartu 40.00 2.00e-27 117.00
IUUC-Tme-127023 Tuber melanosporum 31.80 1.00e-29 124.00
IUUC-Tbe-127453 Tupaia belangeri 91.71 0.00e+00 727.00
IUUC-Ttr-128526 Tursiops truncatus 93.09 0.00e+00 838.00
IUUC-Uma-129660 Ustilago maydis 36.51 3.00e-27 117.00
IUUC-Vda-129737 Verticillium dahliae 36.05 2.00e-22 100.00
IUUC-Vpa-130505 Vicugna pacos 85.49 0.00e+00 664.00
IUUC-Vvi-131088 Vitis vinifera 37.08 9.00e-24 104.00
IUUC-Xtr-132799 Xenopus tropicalis 77.58 0.00e+00 721.00
IUUC-Xma-133345 Xiphophorus maculatus 63.73 2.00e-166 578.00
IUUC-Yli-134416 Yarrowia lipolytica 31.73 3.00e-29 123.00
IUUC-Zma-134750 Zea mays 37.78 2.00e-26 113.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved