• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
UUCD2 ID IUUC-Oan-072946
UUCD1 version UUC-OrA-00665
Ensembl Protein ID ENSOANP00000016038.1
UniProt Accession F7FE20; F7FE20_ORNAN
Protein Name Uncharacterized protein
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSOANG00000010117.2 ENSOANT00000016041.2 ENSOANP00000016038.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 1.40e-18 66.7 13 47
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGnp+++g+CSkC+ree++++r
   Q: 13 DQSELLCKKGCGYYGNPAWQGFCSKCWREEYQKAR 47
    79******************************986 PP
   

Organism Ornithorhynchus anatinus
Protein Sequence
(Fasta)
MSLKSERRGI HVDQSELLCK KGCGYYGNPA WQGFCSKCWR EEYQKARQKQ IQEDWELAER 60
LQREEEEAYA SSHSSQGAQS LTFSKFEEKK TNEKTRKVTT VKKFFSASSR GGPKKAEIHE 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Oan-072946|UBD,ZnF_A20|Ornithorhynchus anatinus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CGTGAGGGTT TCCCACTAAC GCCCCCCGTC CCTCCTCTCC TCTGTCAGCA GGAGGAAGAT 60
GAGCCTGAAG TCCGAACGCA GAGGGATTCA TGTGGATCAG TCCGAGCTCC TGTGCAAGAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Oan-072946|UBD,ZnF_A20|Ornithorhynchus anatinus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0031982--C:vesicle
GO:0003677--F:DNA binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 31.51 3.00e-20 92.40
IUUC-Aml-001771 Ailuropoda melanoleuca 80.00 0.00e+00 686.00
IUUC-Atr-003154 Amborella trichopoda 32.84 5.00e-24 105.00
IUUC-Apl-004018 Anas platyrhynchos 87.45 0.00e+00 813.00
IUUC-Aca-005227 Anolis carolinensis 28.06 3.00e-11 63.20
IUUC-Aly-006138 Arabidopsis lyrata 31.55 7.00e-26 111.00
IUUC-Ath-006929 Arabidopsis thaliana 30.47 7.00e-27 114.00
IUUC-Ago-007776 Ashbya gossypii 29.54 6.00e-23 100.00
IUUC-Acl-008235 Aspergillus clavatus 29.93 2.00e-28 120.00
IUUC-Afl-008570 Aspergillus flavus 31.06 3.00e-30 126.00
IUUC-Afu-008815 Aspergillus fumigatus 28.94 6.00e-29 122.00
IUUC-Ani-009381 Aspergillus nidulans 29.58 3.00e-29 122.00
IUUC-Ang-009615 Aspergillus niger 28.83 5.00e-31 128.00
IUUC-Aor-010195 Aspergillus oryzae 30.85 1.00e-30 127.00
IUUC-Ate-010514 Aspergillus terreus 30.28 1.00e-29 124.00
IUUC-Ame-011365 Astyanax mexicanus 66.60 0.00e+00 664.00
IUUC-Bgr-012102 Blumeria graminis 28.71 2.00e-28 120.00
IUUC-Bta-013124 Bos taurus 90.26 0.00e+00 818.00
IUUC-Bci-013943 Botrytis cinerea 30.60 5.00e-30 125.00
IUUC-Bdi-014539 Brachypodium distachyon 37.22 1.00e-25 110.00
IUUC-Bol-016580 Brassica oleracea 31.80 3.00e-29 122.00
IUUC-Bra-017843 Brassica rapa 31.34 8.00e-29 120.00
IUUC-Cel-018199 Caenorhabditis elegans 33.50 7.00e-57 214.00
IUUC-Cja-019941 Callithrix jacchus 90.47 0.00e+00 821.00
IUUC-Cfa-020845 Canis familiaris 89.59 0.00e+00 748.00
IUUC-Cpo-022037 Cavia porcellus 89.66 0.00e+00 810.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 32.57 1.00e-20 94.00
IUUC-Csa-023495 Chlorocebus sabaeus 90.26 0.00e+00 824.00
IUUC-Cho-025076 Choloepus hoffmanni 88.16 1.00e-170 592.00
IUUC-Cin-025400 Ciona intestinalis 45.33 4.00e-115 407.00
IUUC-Csv-025941 Ciona savignyi 39.18 9.00e-86 310.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 29.33 3.00e-28 119.00
IUUC-Cne-027057 Cryptococcus neoformans 30.93 2.00e-33 136.00
IUUC-Dre-028484 Danio rerio 68.18 0.00e+00 654.00
IUUC-Dno-028906 Dasypus novemcinctus 90.06 0.00e+00 808.00
IUUC-Dor-030124 Dipodomys ordii 81.50 0.00e+00 703.00
IUUC-Dse-031437 Dothistroma septosporum 27.80 9.00e-26 111.00
IUUC-Dme-031696 Drosophila melanogaster 33.06 2.00e-70 259.00
IUUC-Ete-032573 Echinops telfairi 86.97 0.00e+00 672.00
IUUC-Eca-033711 Equus caballus 90.06 0.00e+00 827.00
IUUC-Eeu-034459 Erinaceus europaeus 66.67 9.00e-70 257.00
IUUC-Fca-035447 Felis catus 87.42 0.00e+00 827.00
IUUC-Fal-036605 Ficedula albicollis 85.66 0.00e+00 766.00
IUUC-Fox-037967 Fusarium oxysporum 26.91 3.00e-19 89.70
IUUC-Fso-038110 Fusarium solani 30.10 1.00e-29 124.00
IUUC-Gmo-038785 Gadus morhua 65.75 0.00e+00 672.00
IUUC-Ggr-039760 Gaeumannomyces graminis 30.91 4.00e-27 115.00
IUUC-Gga-040584 Gallus gallus 88.44 0.00e+00 825.00
IUUC-Gac-042469 Gasterosteus aculeatus 62.85 9.00e-166 575.00
IUUC-Gma-044237 Glycine max 34.00 4.00e-27 115.00
IUUC-Ggo-044498 Gorilla gorilla 78.30 0.00e+00 680.00
IUUC-Hsa-046625 Homo sapiens 90.26 0.00e+00 818.00
IUUC-Hvu-047155 Hordeum vulgare 37.22 3.00e-26 112.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 90.06 0.00e+00 820.00
IUUC-Kpa-049160 Komagataella pastoris 29.18 5.00e-25 108.00
IUUC-Lch-050529 Latimeria chalumnae 77.24 0.00e+00 834.00
IUUC-Lpe-051024 Leersia perrieri 33.33 3.00e-28 119.00
IUUC-Loc-052644 Lepisosteus oculatus 68.77 0.00e+00 647.00
IUUC-Lma-053102 Leptosphaeria maculans 30.15 3.00e-26 113.00
IUUC-Laf-054337 Loxodonta africana 90.06 0.00e+00 839.00
IUUC-Mcc-055659 Macaca mulatta 90.38 4.00e-167 580.00
IUUC-Meu-056084 Macropus eugenii 72.40 6.00e-90 323.00
IUUC-Mor-057255 Magnaporthe oryzae 29.35 6.00e-27 115.00
IUUC-Mpo-057454 Magnaporthe poae 30.91 4.00e-29 122.00
IUUC-Mtr-058098 Medicago truncatula 31.76 7.00e-31 127.00
IUUC-Mla-059068 Melampsora laricipopulina 29.29 2.00e-30 125.00
IUUC-Mga-059624 Meleagris gallopavo 75.13 0.00e+00 805.00
IUUC-Mvi-060282 Microbotryum violaceum 28.66 1.00e-25 111.00
IUUC-Mmr-061142 Microcebus murinus 91.08 0.00e+00 850.00
IUUC-Mdo-062289 Monodelphis domestica 90.67 0.00e+00 879.00
IUUC-Mmu-063961 Mus musculus 89.05 0.00e+00 808.00
IUUC-Mac-065188 Musa acuminata 31.76 2.00e-23 102.00
IUUC-Mpu-066291 Mustela putorius furo 89.45 0.00e+00 819.00
IUUC-Mlu-067431 Myotis lucifugus 86.61 0.00e+00 801.00
IUUC-Nfi-068422 Neosartorya fischeri 27.56 7.00e-30 125.00
IUUC-Ncr-068843 Neurospora crassa 29.89 3.00e-29 123.00
IUUC-Nle-069079 Nomascus leucogenys 90.47 0.00e+00 820.00
IUUC-Opr-070790 Ochotona princeps 87.16 2.00e-51 196.00
IUUC-Ont-071789 Oreochromis niloticus 66.60 3.00e-175 607.00
IUUC-Ocu-073816 Oryctolagus cuniculus 90.67 0.00e+00 826.00
IUUC-Oba-075738 Oryza barthii 28.63 1.00e-17 83.60
IUUC-Obr-076355 Oryza brachyantha 35.86 2.00e-27 115.00
IUUC-Ogl-077592 Oryza glaberrima 29.67 3.00e-30 125.00
IUUC-Ogu-078197 Oryza glumaepatula 29.92 1.00e-29 123.00
IUUC-Oin-079629 Oryza indica 29.92 6.00e-30 124.00
IUUC-Olo-080317 Oryza longistaminata 29.92 2.00e-29 122.00
IUUC-Ome-081589 Oryza meridionalis 32.68 2.00e-26 113.00
IUUC-Oni-082700 Oryza nivara 28.63 1.00e-17 84.00
IUUC-Opu-083923 Oryza punctata 34.07 7.00e-23 100.00
IUUC-Oru-084318 Oryza rufipogon 28.63 1.00e-17 84.00
IUUC-Osa-086246 Oryza sativa 37.29 1.00e-07 47.00
IUUC-Ola-086730 Oryzias latipes 57.91 2.00e-148 518.00
IUUC-Olu-087719 Ostreococcus lucimarinus 32.07 3.00e-22 99.00
IUUC-Oga-088992 Otolemur garnettii 78.73 0.00e+00 838.00
IUUC-Oar-089789 Ovis aries 90.49 0.00e+00 822.00
IUUC-Ptr-091636 Pan troglodytes 90.26 0.00e+00 816.00
IUUC-Pan-092911 Papio anubis 89.86 0.00e+00 815.00
IUUC-Psi-093194 Pelodiscus sinensis 75.87 0.00e+00 815.00
IUUC-Pma-094212 Petromyzon marinus 49.10 6.00e-116 410.00
IUUC-Pno-094831 Phaeosphaeria nodorum 29.75 3.00e-27 116.00
IUUC-Ppa-095705 Physcomitrella patens 35.26 2.00e-31 130.00
IUUC-Pfo-097510 Poecilia formosa 64.66 1.00e-158 552.00
IUUC-Pab-097706 Pongo abelii 90.06 0.00e+00 816.00
IUUC-Pop-099891 Populus trichocarpa 34.44 4.00e-25 108.00
IUUC-Pca-100879 Procavia capensis 86.92 2.00e-89 321.00
IUUC-Ppe-101334 Prunus persica 30.08 9.00e-28 117.00
IUUC-Pva-103225 Pteropus vampyrus 76.46 0.00e+00 661.00
IUUC-Pgr-103564 Puccinia graminis 28.06 2.00e-29 123.00
IUUC-Ptt-103802 Puccinia triticina 28.06 2.00e-24 106.00
IUUC-Pte-104345 Pyrenophora teres 29.56 9.00e-27 114.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 29.75 1.00e-27 117.00
IUUC-Rno-106101 Rattus norvegicus 89.45 0.00e+00 813.00
IUUC-Sce-106460 Saccharomyces cerevisiae 31.15 7.00e-26 110.00
IUUC-Sha-106919 Sarcophilus harrisii 78.13 0.00e+00 813.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 32.06 6.00e-31 128.00
IUUC-Spo-108087 Schizosaccharomyces pombe 30.08 1.00e-27 117.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 28.10 4.00e-07 49.30
IUUC-Smo-108740 Selaginella moellendorffii 36.11 2.00e-28 119.00
IUUC-Sit-110678 Setaria italica 36.67 1.00e-26 113.00
IUUC-Sly-111526 Solanum lycopersicum 36.31 4.00e-27 115.00
IUUC-Stu-112494 Solanum tuberosum 36.31 2.00e-27 115.00
IUUC-Sar-112929 Sorex araneus 90.58 6.00e-151 526.00
IUUC-Sbi-114242 Sorghum bicolor 31.91 1.00e-28 120.00
IUUC-Sre-115224 Sporisorium reilianum 29.66 9.00e-27 115.00
IUUC-Ssc-115239 Sus scrofa 90.47 0.00e+00 823.00
IUUC-Tgu-117499 Taeniopygia guttata 86.82 0.00e+00 803.00
IUUC-Tru-118450 Takifugu rubripes 57.98 2.00e-169 588.00
IUUC-Tsy-119462 Tarsius syrichta 89.33 0.00e+00 807.00
IUUC-Tni-120855 Tetraodon nigroviridis 59.44 8.00e-169 586.00
IUUC-Tca-121213 Theobroma cacao 29.13 1.00e-25 110.00
IUUC-Tre-122186 Trichoderma reesei 30.41 2.00e-28 119.00
IUUC-Tvi-122541 Trichoderma virens 27.97 2.00e-28 119.00
IUUC-Tae-123631 Triticum aestivum 34.63 1.00e-27 117.00
IUUC-Tur-126572 Triticum urartu 38.33 3.00e-26 112.00
IUUC-Tme-127023 Tuber melanosporum 32.53 7.00e-31 128.00
IUUC-Tbe-127453 Tupaia belangeri 88.89 0.00e+00 712.00
IUUC-Ttr-128526 Tursiops truncatus 90.06 0.00e+00 815.00
IUUC-Uma-129660 Ustilago maydis 30.92 1.00e-27 118.00
IUUC-Vda-129737 Verticillium dahliae 28.98 4.00e-25 109.00
IUUC-Vpa-130505 Vicugna pacos 82.17 0.00e+00 645.00
IUUC-Vvi-131088 Vitis vinifera 33.71 1.00e-23 103.00
IUUC-Xtr-132799 Xenopus tropicalis 79.15 0.00e+00 737.00
IUUC-Xma-133345 Xiphophorus maculatus 63.80 9.00e-167 579.00
IUUC-Yli-134416 Yarrowia lipolytica 32.26 4.00e-31 129.00
IUUC-Zma-134750 Zea mays 36.11 8.00e-26 110.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved