• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Oga-088992
Ensembl Protein ID ENSOGAP00000007311.2
UniProt Accession H0WXV6; H0WXV6_OTOGA
Genbank Protein ID ENSOGAP00000007311
Protein Name Uncharacterized protein
Genbank Nucleotide ID AAQR03108890
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSOGAG00000008166.2 ENSOGAT00000008173.2 ENSOGAP00000007311.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 3.80e-18 65.1 151 185
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGnp+++g+CSkC+ree++++r
   Q: 151 DQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKAR 185
    79*******************************86 PP
   

Organism Otolemur garnettii
Protein Sequence
(Fasta)
MVVVTGRELD SRRPDGAMSS SDAEDDFLEP ATPTATQAGH ALPLMPQERR TEFPAFRGPA 60
SLGASAGCVQ RGPVLCHWTP PGTAGEHAAA EGREGAPGVS GTHALLQRPF GADCGDRPAA 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Oga-088992|UBD,ZnF_A20|Otolemur garnettii
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGTGGTAG TCACGGGGCG GGAGCTAGAC AGCCGTCGCC CGGACGGTGC CATGTCCAGC 60
TCCGACGCCG AAGACGACTT TCTGGAGCCG GCCACTCCGA CGGCCACGCA GGCAGGGCAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Oga-088992|UBD,ZnF_A20|Otolemur garnettii
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0005730--C:nucleolus
GO:0003677--F:DNA binding
GO:0017112--F:Rab guanyl-nucleotide exchange factor activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0006612--P:protein targeting to membrane
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 31.96 6.00e-21 95.50
IUUC-Aml-001771 Ailuropoda melanoleuca 84.76 0.00e+00 1102.00
IUUC-Atr-003154 Amborella trichopoda 36.52 7.00e-23 101.00
IUUC-Apl-004018 Anas platyrhynchos 80.14 0.00e+00 830.00
IUUC-Aca-005227 Anolis carolinensis 24.43 7.00e-09 56.20
IUUC-Aly-006138 Arabidopsis lyrata 35.45 5.00e-25 108.00
IUUC-Ath-006747 Arabidopsis thaliana 34.92 1.00e-24 107.00
IUUC-Ago-007776 Ashbya gossypii 31.58 2.00e-22 100.00
IUUC-Acl-008235 Aspergillus clavatus 37.99 4.00e-27 116.00
IUUC-Afl-008570 Aspergillus flavus 39.38 8.00e-30 125.00
IUUC-Afu-008815 Aspergillus fumigatus 37.31 2.00e-27 117.00
IUUC-Ani-009381 Aspergillus nidulans 37.50 9.00e-28 118.00
IUUC-Ang-009615 Aspergillus niger 33.64 2.00e-29 123.00
IUUC-Aor-010195 Aspergillus oryzae 39.38 5.00e-30 125.00
IUUC-Ate-010514 Aspergillus terreus 38.74 1.00e-28 121.00
IUUC-Ame-011365 Astyanax mexicanus 63.93 8.00e-156 543.00
IUUC-Bgr-012102 Blumeria graminis 32.54 2.00e-27 117.00
IUUC-Bta-013124 Bos taurus 89.34 0.00e+00 760.00
IUUC-Bci-013943 Botrytis cinerea 34.13 4.00e-28 119.00
IUUC-Bdi-014539 Brachypodium distachyon 37.78 2.00e-26 113.00
IUUC-Bol-016580 Brassica oleracea 37.57 2.00e-29 123.00
IUUC-Bra-017843 Brassica rapa 37.04 5.00e-29 122.00
IUUC-Cel-018199 Caenorhabditis elegans 43.69 3.00e-47 182.00
IUUC-Cja-019941 Callithrix jacchus 89.10 0.00e+00 758.00
IUUC-Cfa-020845 Canis familiaris 89.57 0.00e+00 764.00
IUUC-Cpo-022037 Cavia porcellus 88.15 0.00e+00 747.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 34.09 5.00e-21 95.90
IUUC-Csa-023495 Chlorocebus sabaeus 88.86 0.00e+00 761.00
IUUC-Cho-025076 Choloepus hoffmanni 86.24 7.00e-179 620.00
IUUC-Cin-025400 Ciona intestinalis 39.51 3.00e-108 385.00
IUUC-Csv-025941 Ciona savignyi 35.32 4.00e-80 292.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 31.73 5.00e-26 112.00
IUUC-Cne-027057 Cryptococcus neoformans 29.97 1.00e-31 131.00
IUUC-Dre-028484 Danio rerio 61.00 0.00e+00 637.00
IUUC-Dno-028906 Dasypus novemcinctus 89.23 0.00e+00 753.00
IUUC-Dor-030124 Dipodomys ordii 95.56 3.00e-143 501.00
IUUC-Dse-031437 Dothistroma septosporum 26.28 1.00e-24 108.00
IUUC-Dme-031696 Drosophila melanogaster 29.50 7.00e-64 238.00
IUUC-Ete-032573 Echinops telfairi 84.91 0.00e+00 705.00
IUUC-Eca-033711 Equus caballus 90.07 0.00e+00 763.00
IUUC-Eeu-034459 Erinaceus europaeus 73.43 5.00e-78 285.00
IUUC-Fca-035447 Felis catus 89.06 0.00e+00 765.00
IUUC-Fal-036605 Ficedula albicollis 77.44 0.00e+00 774.00
IUUC-Fox-037967 Fusarium oxysporum 28.57 3.00e-17 84.00
IUUC-Fso-038110 Fusarium solani 32.54 1.00e-27 118.00
IUUC-Gmo-038785 Gadus morhua 58.32 0.00e+00 639.00
IUUC-Ggr-039760 Gaeumannomyces graminis 39.35 1.00e-27 118.00
IUUC-Gga-040584 Gallus gallus 80.99 0.00e+00 843.00
IUUC-Gac-042469 Gasterosteus aculeatus 56.20 2.00e-158 551.00
IUUC-Gma-044237 Glycine max 37.43 3.00e-26 113.00
IUUC-Ggo-044498 Gorilla gorilla 74.29 5.00e-178 617.00
IUUC-Hsa-046625 Homo sapiens 89.34 0.00e+00 760.00
IUUC-Hvu-047155 Hordeum vulgare 37.78 8.00e-27 114.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 88.63 0.00e+00 752.00
IUUC-Kpa-049160 Komagataella pastoris 27.44 6.00e-23 102.00
IUUC-Lch-050529 Latimeria chalumnae 76.31 0.00e+00 872.00
IUUC-Lpe-051024 Leersia perrieri 34.39 7.00e-29 121.00
IUUC-Loc-052644 Lepisosteus oculatus 67.15 4.00e-158 551.00
IUUC-Lma-053102 Leptosphaeria maculans 36.00 6.00e-26 112.00
IUUC-Laf-054337 Loxodonta africana 82.75 0.00e+00 853.00
IUUC-Mcc-055659 Macaca mulatta 84.64 2.00e-140 491.00
IUUC-Meu-056084 Macropus eugenii 77.38 2.00e-95 342.00
IUUC-Mor-057255 Magnaporthe oryzae 37.42 2.00e-25 111.00
IUUC-Mpo-057454 Magnaporthe poae 33.99 3.00e-28 119.00
IUUC-Mtr-058098 Medicago truncatula 36.65 4.00e-29 122.00
IUUC-Mla-059068 Melampsora laricipopulina 35.87 2.00e-30 126.00
IUUC-Mga-059624 Meleagris gallopavo 75.72 0.00e+00 907.00
IUUC-Mvi-060282 Microbotryum violaceum 30.36 4.00e-23 103.00
IUUC-Mmr-061142 Microcebus murinus 84.91 0.00e+00 880.00
IUUC-Mdo-062289 Monodelphis domestica 85.71 0.00e+00 774.00
IUUC-Mmu-063961 Mus musculus 88.15 0.00e+00 749.00
IUUC-Mac-065188 Musa acuminata 36.31 1.00e-22 100.00
IUUC-Mpu-066291 Mustela putorius furo 88.86 0.00e+00 763.00
IUUC-Mlu-067431 Myotis lucifugus 80.10 0.00e+00 837.00
IUUC-Nfi-068422 Neosartorya fischeri 37.89 1.00e-28 121.00
IUUC-Ncr-068843 Neurospora crassa 31.98 5.00e-28 119.00
IUUC-Nle-069079 Nomascus leucogenys 89.10 0.00e+00 757.00
IUUC-Opr-070790 Ochotona princeps 97.22 3.00e-58 219.00
IUUC-Ont-071789 Oreochromis niloticus 60.11 3.00e-169 587.00
IUUC-Oan-072946 Ornithorhynchus anatinus 83.04 0.00e+00 701.00
IUUC-Ocu-073816 Oryctolagus cuniculus 90.05 0.00e+00 767.00
IUUC-Oba-075738 Oryza barthii 33.15 1.00e-17 84.30
IUUC-Obr-076355 Oryza brachyantha 37.91 1.00e-27 117.00
IUUC-Ogl-077592 Oryza glaberrima 34.39 4.00e-27 115.00
IUUC-Ogu-078197 Oryza glumaepatula 33.50 7.00e-27 114.00
IUUC-Oin-080047 Oryza indica 37.64 9.00e-26 111.00
IUUC-Olo-080317 Oryza longistaminata 34.39 1.00e-26 114.00
IUUC-Ome-081589 Oryza meridionalis 37.22 2.00e-26 114.00
IUUC-Oni-082700 Oryza nivara 33.15 1.00e-17 84.70
IUUC-Opu-083923 Oryza punctata 34.36 1.00e-21 97.10
IUUC-Oru-084318 Oryza rufipogon 33.15 1.00e-17 84.70
IUUC-Osa-086246 Oryza sativa 38.98 5.00e-07 45.40
IUUC-Ola-086730 Oryzias latipes 54.68 2.00e-151 528.00
IUUC-Olu-087719 Ostreococcus lucimarinus 34.46 1.00e-23 104.00
IUUC-Oar-089789 Ovis aries 89.60 0.00e+00 764.00
IUUC-Ptr-091636 Pan troglodytes 89.34 0.00e+00 758.00
IUUC-Pan-092911 Papio anubis 88.63 0.00e+00 755.00
IUUC-Psi-093194 Pelodiscus sinensis 81.12 0.00e+00 905.00
IUUC-Pma-094212 Petromyzon marinus 43.08 3.00e-108 385.00
IUUC-Pno-094831 Phaeosphaeria nodorum 33.33 2.00e-26 114.00
IUUC-Ppa-095705 Physcomitrella patens 33.33 4.00e-30 125.00
IUUC-Pfo-096694 Poecilia formosa 56.78 2.00e-167 582.00
IUUC-Pab-097706 Pongo abelii 89.10 0.00e+00 758.00
IUUC-Pop-099891 Populus trichocarpa 37.43 1.00e-25 111.00
IUUC-Pca-100879 Procavia capensis 80.80 7.00e-93 333.00
IUUC-Ppe-101334 Prunus persica 35.98 4.00e-26 112.00
IUUC-Pva-103225 Pteropus vampyrus 80.38 7.00e-169 587.00
IUUC-Pgr-103564 Puccinia graminis 34.41 1.00e-29 125.00
IUUC-Ptt-103802 Puccinia triticina 46.02 7.00e-25 108.00
IUUC-Pte-104345 Pyrenophora teres 34.16 5.00e-26 113.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 34.30 8.00e-27 115.00
IUUC-Rno-106101 Rattus norvegicus 87.91 0.00e+00 751.00
IUUC-Sce-106460 Saccharomyces cerevisiae 33.84 2.00e-23 103.00
IUUC-Sha-106919 Sarcophilus harrisii 78.33 0.00e+00 937.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 37.50 3.00e-29 123.00
IUUC-Spo-108087 Schizosaccharomyces pombe 32.81 3.00e-26 112.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 29.82 1.00e-07 52.00
IUUC-Smo-109411 Selaginella moellendorffii 37.22 5.00e-29 122.00
IUUC-Sit-110678 Setaria italica 37.22 9.00e-27 114.00
IUUC-Sly-111526 Solanum lycopersicum 37.85 7.00e-26 111.00
IUUC-Stu-112494 Solanum tuberosum 36.93 2.00e-26 113.00
IUUC-Sar-112929 Sorex araneus 98.55 3.00e-163 568.00
IUUC-Sbi-114242 Sorghum bicolor 36.13 2.00e-27 117.00
IUUC-Sre-115224 Sporisorium reilianum 36.13 1.00e-28 122.00
IUUC-Ssc-115239 Sus scrofa 89.57 0.00e+00 766.00
IUUC-Tgu-117499 Taeniopygia guttata 78.70 0.00e+00 810.00
IUUC-Tru-118027 Takifugu rubripes 56.78 5.00e-163 567.00
IUUC-Tsy-119462 Tarsius syrichta 84.45 0.00e+00 849.00
IUUC-Tni-120855 Tetraodon nigroviridis 53.29 2.00e-164 572.00
IUUC-Tca-121213 Theobroma cacao 35.45 4.00e-25 108.00
IUUC-Tre-122186 Trichoderma reesei 31.62 1.00e-27 117.00
IUUC-Tvi-122541 Trichoderma virens 38.73 2.00e-27 117.00
IUUC-Tae-122942 Triticum aestivum 38.89 4.00e-27 115.00
IUUC-Tur-126572 Triticum urartu 38.89 6.00e-27 115.00
IUUC-Tme-127023 Tuber melanosporum 37.91 9.00e-30 125.00
IUUC-Tbe-127453 Tupaia belangeri 90.05 0.00e+00 764.00
IUUC-Ttr-128526 Tursiops truncatus 89.10 0.00e+00 758.00
IUUC-Uma-129660 Ustilago maydis 36.51 1.00e-28 122.00
IUUC-Vda-129737 Verticillium dahliae 30.59 4.00e-23 103.00
IUUC-Vpa-130505 Vicugna pacos 83.41 0.00e+00 694.00
IUUC-Vvi-131088 Vitis vinifera 37.08 3.00e-24 106.00
IUUC-Xtr-132799 Xenopus tropicalis 69.39 0.00e+00 721.00
IUUC-Xma-133345 Xiphophorus maculatus 57.34 4.00e-163 567.00
IUUC-Yli-134416 Yarrowia lipolytica 29.41 8.00e-30 125.00
IUUC-Zma-134750 Zea mays 37.78 2.00e-26 113.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved