• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
UUCD2 ID IUUC-Pab-097706
UUCD1 version UUC-PoA-00771
Ensembl Protein ID ENSPPYP00000019637.2
UniProt Accession H2PM01; H2PM01_PONAB
Genbank Protein ID ENSPPYP00000019637
Protein Name Uncharacterized protein
Genbank Nucleotide ID ABGA01253890
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSPPYG00000017520.2 ENSPPYT00000020410.2 ENSPPYP00000019637.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 5.20e-19 68.0 66 100
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGnp+++g+CSkC+ree++++r
   Q: 66 DQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKAR 100
    79*******************************86 PP
   

Organism Pongo abelii
Protein Sequence
(Fasta)
RYAPCVTCVR CVPGRASRRV GVRRELAAEP RPTRAKWASG GWTPAETRAS RKKMSLKSER 60
RGIHVDQSDL LCKKGCGYYG NPAWQGFCSK CWREEYHKAR QKQIQEDWEL AERLQREEEE 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Pab-097706|UBD,ZnF_A20|Pongo abelii
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ACGTTACGCG CCGTGCGTAA CGTGCGTTCG CTGCGTGCCG GGGCGGGCGA GCAGGAGGGT 60
GGGTGTGAGG CGGGAGCTGG CCGCGGAGCC CAGACCTACC CGAGCGAAGT GGGCGAGCGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Pab-097706|UBD,ZnF_A20|Pongo abelii
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0005730--C:nucleolus
GO:0003677--F:DNA binding
GO:0017112--F:Rab guanyl-nucleotide exchange factor activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0006612--P:protein targeting to membrane
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 32.42 3.00e-21 96.30
IUUC-Aml-001771 Ailuropoda melanoleuca 87.03 0.00e+00 741.00
IUUC-Atr-003154 Amborella trichopoda 36.11 7.00e-23 101.00
IUUC-Apl-004018 Anas platyrhynchos 91.26 0.00e+00 840.00
IUUC-Aca-005227 Anolis carolinensis 23.47 3.00e-09 57.00
IUUC-Aly-006138 Arabidopsis lyrata 33.96 4.00e-25 109.00
IUUC-Ath-006929 Arabidopsis thaliana 32.89 2.00e-26 113.00
IUUC-Ago-007776 Ashbya gossypii 30.13 5.00e-25 108.00
IUUC-Acl-008235 Aspergillus clavatus 31.47 2.00e-29 124.00
IUUC-Afl-008570 Aspergillus flavus 32.45 3.00e-32 133.00
IUUC-Afu-008815 Aspergillus fumigatus 31.13 3.00e-30 127.00
IUUC-Ani-009381 Aspergillus nidulans 31.12 8.00e-30 125.00
IUUC-Ang-009615 Aspergillus niger 31.27 2.00e-32 133.00
IUUC-Aor-010195 Aspergillus oryzae 32.45 1.00e-32 134.00
IUUC-Ate-010514 Aspergillus terreus 32.17 6.00e-31 129.00
IUUC-Ame-011365 Astyanax mexicanus 65.74 0.00e+00 662.00
IUUC-Bgr-012102 Blumeria graminis 28.80 8.00e-30 125.00
IUUC-Bta-013124 Bos taurus 97.15 0.00e+00 881.00
IUUC-Bci-013943 Botrytis cinerea 30.77 2.00e-30 127.00
IUUC-Bdi-014539 Brachypodium distachyon 38.33 1.00e-26 114.00
IUUC-Bol-016580 Brassica oleracea 35.14 3.00e-30 126.00
IUUC-Bra-017843 Brassica rapa 34.68 4.00e-30 125.00
IUUC-Cel-018199 Caenorhabditis elegans 33.85 2.00e-58 219.00
IUUC-Cja-019941 Callithrix jacchus 99.19 0.00e+00 909.00
IUUC-Cfa-020845 Canis familiaris 96.52 0.00e+00 803.00
IUUC-Cpo-022037 Cavia porcellus 95.93 0.00e+00 870.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 32.49 5.00e-21 95.50
IUUC-Csa-023495 Chlorocebus sabaeus 99.39 0.00e+00 902.00
IUUC-Cho-025076 Choloepus hoffmanni 84.32 0.00e+00 728.00
IUUC-Cin-025400 Ciona intestinalis 43.45 7.00e-113 400.00
IUUC-Csv-025941 Ciona savignyi 37.37 2.00e-84 306.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 29.02 4.00e-27 116.00
IUUC-Cne-027057 Cryptococcus neoformans 31.76 8.00e-35 142.00
IUUC-Dre-028484 Danio rerio 69.31 0.00e+00 667.00
IUUC-Dno-028906 Dasypus novemcinctus 96.34 0.00e+00 859.00
IUUC-Dor-030124 Dipodomys ordii 86.33 0.00e+00 751.00
IUUC-Dse-031437 Dothistroma septosporum 29.43 2.00e-26 114.00
IUUC-Dme-031696 Drosophila melanogaster 33.33 2.00e-68 253.00
IUUC-Ete-032573 Echinops telfairi 91.73 0.00e+00 715.00
IUUC-Eca-033711 Equus caballus 97.15 0.00e+00 884.00
IUUC-Eeu-034459 Erinaceus europaeus 71.84 9.00e-77 281.00
IUUC-Fca-035447 Felis catus 94.09 0.00e+00 889.00
IUUC-Fal-036605 Ficedula albicollis 87.89 0.00e+00 778.00
IUUC-Fox-037967 Fusarium oxysporum 27.08 7.00e-19 89.00
IUUC-Fso-038110 Fusarium solani 29.67 3.00e-29 123.00
IUUC-Gmo-038785 Gadus morhua 66.40 0.00e+00 672.00
IUUC-Ggr-039760 Gaeumannomyces graminis 30.69 2.00e-27 117.00
IUUC-Gga-040584 Gallus gallus 91.87 0.00e+00 841.00
IUUC-Gac-042469 Gasterosteus aculeatus 63.58 4.00e-165 574.00
IUUC-Gma-044237 Glycine max 37.43 2.00e-26 113.00
IUUC-Ggo-044498 Gorilla gorilla 85.57 0.00e+00 748.00
IUUC-Hsa-046625 Homo sapiens 99.60 0.00e+00 912.00
IUUC-Hvu-047155 Hordeum vulgare 38.33 6.00e-27 115.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 96.33 0.00e+00 875.00
IUUC-Kpa-049160 Komagataella pastoris 29.05 2.00e-24 107.00
IUUC-Lch-050529 Latimeria chalumnae 78.88 0.00e+00 850.00
IUUC-Lpe-051024 Leersia perrieri 34.84 7.00e-29 121.00
IUUC-Loc-052644 Lepisosteus oculatus 70.02 0.00e+00 661.00
IUUC-Lma-053102 Leptosphaeria maculans 30.99 4.00e-28 120.00
IUUC-Laf-054337 Loxodonta africana 94.09 0.00e+00 860.00
IUUC-Mcc-055659 Macaca mulatta 98.90 0.00e+00 632.00
IUUC-Meu-056084 Macropus eugenii 76.02 9.00e-95 340.00
IUUC-Mor-057255 Magnaporthe oryzae 29.60 7.00e-27 115.00
IUUC-Mpo-057454 Magnaporthe poae 30.69 3.00e-29 123.00
IUUC-Mtr-058098 Medicago truncatula 36.16 3.00e-30 126.00
IUUC-Mla-059068 Melampsora laricipopulina 30.83 9.00e-31 127.00
IUUC-Mga-059624 Meleagris gallopavo 77.29 0.00e+00 839.00
IUUC-Mvi-060282 Microbotryum violaceum 28.83 5.00e-26 113.00
IUUC-Mmr-061142 Microcebus murinus 96.96 0.00e+00 891.00
IUUC-Mdo-062289 Monodelphis domestica 91.85 0.00e+00 891.00
IUUC-Mmu-063961 Mus musculus 95.52 0.00e+00 868.00
IUUC-Mac-065188 Musa acuminata 32.55 7.00e-23 101.00
IUUC-Mpu-066291 Mustela putorius furo 95.97 0.00e+00 877.00
IUUC-Mlu-067431 Myotis lucifugus 92.14 0.00e+00 839.00
IUUC-Nfi-068422 Neosartorya fischeri 31.13 8.00e-31 129.00
IUUC-Ncr-068843 Neurospora crassa 29.93 2.00e-28 121.00
IUUC-Nle-069079 Nomascus leucogenys 99.59 0.00e+00 901.00
IUUC-Opr-070790 Ochotona princeps 93.52 4.00e-57 216.00
IUUC-Ont-071789 Oreochromis niloticus 68.97 5.00e-178 617.00
IUUC-Oan-072946 Ornithorhynchus anatinus 90.06 0.00e+00 811.00
IUUC-Ocu-073816 Oryctolagus cuniculus 97.37 0.00e+00 882.00
IUUC-Oba-075738 Oryza barthii 33.33 9.00e-18 84.70
IUUC-Obr-076355 Oryza brachyantha 38.46 7.00e-28 118.00
IUUC-Ogl-077217 Oryza glaberrima 36.76 2.00e-24 107.00
IUUC-Ogu-078197 Oryza glumaepatula 34.03 1.00e-25 110.00
IUUC-Oin-080047 Oryza indica 37.78 5.00e-26 112.00
IUUC-Olo-080317 Oryza longistaminata 33.86 2.00e-25 109.00
IUUC-Ome-081589 Oryza meridionalis 37.78 1.00e-26 115.00
IUUC-Oni-082700 Oryza nivara 33.33 7.00e-18 85.10
IUUC-Opu-083923 Oryza punctata 32.07 1.00e-20 93.60
IUUC-Oru-084318 Oryza rufipogon 33.33 7.00e-18 85.10
IUUC-Osa-086246 Oryza sativa 38.98 7.00e-07 44.70
IUUC-Ola-086730 Oryzias latipes 57.06 2.00e-149 521.00
IUUC-Olu-087719 Ostreococcus lucimarinus 35.03 3.00e-24 106.00
IUUC-Oga-088992 Otolemur garnettii 84.41 0.00e+00 884.00
IUUC-Oar-089789 Ovis aries 96.78 0.00e+00 881.00
IUUC-Ptr-091636 Pan troglodytes 99.80 0.00e+00 904.00
IUUC-Pan-092911 Papio anubis 98.99 0.00e+00 904.00
IUUC-Psi-093194 Pelodiscus sinensis 77.85 0.00e+00 828.00
IUUC-Pma-094212 Petromyzon marinus 48.29 1.00e-113 403.00
IUUC-Pno-094831 Phaeosphaeria nodorum 30.53 5.00e-28 119.00
IUUC-Ppa-095705 Physcomitrella patens 34.39 2.00e-29 123.00
IUUC-Pfo-096694 Poecilia formosa 64.62 2.00e-177 614.00
IUUC-Pop-099891 Populus trichocarpa 37.78 4.00e-26 112.00
IUUC-Pca-100879 Procavia capensis 92.96 2.00e-90 325.00
IUUC-Ppe-101334 Prunus persica 33.78 1.00e-26 114.00
IUUC-Pva-103225 Pteropus vampyrus 81.01 0.00e+00 705.00
IUUC-Pgr-103564 Puccinia graminis 30.77 1.00e-31 131.00
IUUC-Ptt-103802 Puccinia triticina 29.84 1.00e-25 111.00
IUUC-Pte-104345 Pyrenophora teres 29.43 4.00e-28 120.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 30.50 9.00e-29 122.00
IUUC-Rno-106101 Rattus norvegicus 95.14 0.00e+00 873.00
IUUC-Sce-106460 Saccharomyces cerevisiae 30.77 3.00e-25 109.00
IUUC-Sha-106919 Sarcophilus harrisii 76.23 0.00e+00 845.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 32.17 4.00e-30 125.00
IUUC-Spo-108087 Schizosaccharomyces pombe 29.84 4.00e-27 116.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 29.82 1.00e-07 52.00
IUUC-Smo-109411 Selaginella moellendorffii 36.57 2.00e-27 117.00
IUUC-Sit-110678 Setaria italica 37.78 5.00e-27 115.00
IUUC-Sly-111526 Solanum lycopersicum 37.85 9.00e-26 111.00
IUUC-Stu-112494 Solanum tuberosum 38.42 2.00e-26 113.00
IUUC-Sar-112929 Sorex araneus 97.09 2.00e-161 562.00
IUUC-Sbi-114242 Sorghum bicolor 35.45 3.00e-28 119.00
IUUC-Sre-115224 Sporisorium reilianum 32.14 6.00e-31 129.00
IUUC-Ssc-115239 Sus scrofa 96.95 0.00e+00 877.00
IUUC-Tgu-117499 Taeniopygia guttata 89.61 0.00e+00 820.00
IUUC-Tru-118027 Takifugu rubripes 63.35 8.00e-142 496.00
IUUC-Tsy-119462 Tarsius syrichta 97.27 0.00e+00 861.00
IUUC-Tni-120855 Tetraodon nigroviridis 64.54 1.00e-172 599.00
IUUC-Tca-121213 Theobroma cacao 32.27 1.00e-24 107.00
IUUC-Tre-122186 Trichoderma reesei 29.74 1.00e-29 124.00
IUUC-Tvi-122541 Trichoderma virens 27.89 2.00e-29 124.00
IUUC-Tae-123631 Triticum aestivum 39.44 2.00e-27 117.00
IUUC-Tur-126572 Triticum urartu 39.44 4.00e-27 115.00
IUUC-Tme-127023 Tuber melanosporum 32.94 9.00e-32 131.00
IUUC-Tbe-127453 Tupaia belangeri 96.88 0.00e+00 775.00
IUUC-Ttr-128526 Tursiops truncatus 96.95 0.00e+00 879.00
IUUC-Uma-129660 Ustilago maydis 32.95 1.00e-31 132.00
IUUC-Vda-129737 Verticillium dahliae 28.62 2.00e-24 107.00
IUUC-Vpa-130505 Vicugna pacos 90.91 0.00e+00 714.00
IUUC-Vvi-131088 Vitis vinifera 37.08 1.00e-23 104.00
IUUC-Xtr-132799 Xenopus tropicalis 79.76 0.00e+00 738.00
IUUC-Xma-133345 Xiphophorus maculatus 65.23 1.00e-173 602.00
IUUC-Yli-134416 Yarrowia lipolytica 32.12 1.00e-31 130.00
IUUC-Zma-134750 Zea mays 37.78 1.00e-26 114.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved