• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Ssc-115239
Ensembl Protein ID ENSSSCP00000008261.2
UniProt Accession F1RJI2; F1RJI2_PIG
Genbank Protein ID ENSSSCP00000008261
Protein Name Uncharacterized protein
Genbank Nucleotide ID FP340504
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSSSCG00000007735.2 ENSSSCT00000008480.2 ENSSSCP00000008261.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 1.10e-18 67.1 13 47
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGnp+++g+CSkC+ree++++r
   Q: 13 DQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKAR 47
    79*******************************86 PP
   

Organism Sus scrofa
Protein Sequence
(Fasta)
MSLKSERRGI HVDQSELLCK KGCGYYGNPA WQGFCSKCWR EEYHKARQKQ IQEDWELAER 60
LQREEEEAFA SSQSSQGAQS LTFSKFEEKK TNEKTRKVTT VKKFFSASSR VGSKKAEIQE 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ssc-115239|UBD,ZnF_A20|Sus scrofa
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGCTTCTGAA CGCTCCAGGT CAGGGACCCA GCACTAGGGC TGAGGGCGCC TCCTTCCTCA 60
TGCCCGACGG CTTTGTCGCC ACTGTCATCC ACGCCAGCCT CGCCCTCGCG CCACCCAGGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ssc-115239|UBD,ZnF_A20|Sus scrofa
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1267--Proteomics identification
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0005730--C:nucleolus
GO:0003677--F:DNA binding
GO:0017112--F:Rab guanyl-nucleotide exchange factor activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0006612--P:protein targeting to membrane
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 31.96 1.00e-20 94.00
IUUC-Aml-001771 Ailuropoda melanoleuca 88.92 0.00e+00 764.00
IUUC-Atr-003154 Amborella trichopoda 36.52 1.00e-22 100.00
IUUC-Apl-004018 Anas platyrhynchos 91.48 0.00e+00 843.00
IUUC-Aca-005227 Anolis carolinensis 22.96 1.00e-08 54.70
IUUC-Aly-006138 Arabidopsis lyrata 35.45 8.00e-25 108.00
IUUC-Ath-006929 Arabidopsis thaliana 32.14 9.00e-26 110.00
IUUC-Ago-007776 Ashbya gossypii 30.00 5.00e-24 105.00
IUUC-Acl-008235 Aspergillus clavatus 31.12 4.00e-29 123.00
IUUC-Afl-008570 Aspergillus flavus 32.12 7.00e-32 132.00
IUUC-Afu-008815 Aspergillus fumigatus 30.90 1.00e-29 124.00
IUUC-Ani-009381 Aspergillus nidulans 30.39 6.00e-30 125.00
IUUC-Ang-009615 Aspergillus niger 29.28 3.00e-32 132.00
IUUC-Aor-010195 Aspergillus oryzae 31.79 2.00e-32 133.00
IUUC-Ate-010514 Aspergillus terreus 31.82 1.00e-30 128.00
IUUC-Ame-011365 Astyanax mexicanus 66.60 0.00e+00 669.00
IUUC-Bgr-012102 Blumeria graminis 28.85 5.00e-30 125.00
IUUC-Bta-013124 Bos taurus 98.37 0.00e+00 894.00
IUUC-Bci-013943 Botrytis cinerea 30.50 3.00e-30 126.00
IUUC-Bdi-014539 Brachypodium distachyon 33.94 4.00e-26 112.00
IUUC-Bol-016580 Brassica oleracea 35.14 3.00e-30 125.00
IUUC-Bra-017843 Brassica rapa 34.68 5.00e-30 125.00
IUUC-Cel-018199 Caenorhabditis elegans 34.10 1.00e-59 223.00
IUUC-Cja-019941 Callithrix jacchus 97.15 0.00e+00 881.00
IUUC-Cfa-020845 Canis familiaris 98.48 0.00e+00 826.00
IUUC-Cpo-022037 Cavia porcellus 96.75 0.00e+00 876.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 32.49 9.00e-22 97.80
IUUC-Csa-023495 Chlorocebus sabaeus 96.75 0.00e+00 882.00
IUUC-Cho-025076 Choloepus hoffmanni 85.77 0.00e+00 740.00
IUUC-Cin-025400 Ciona intestinalis 45.02 4.00e-117 414.00
IUUC-Csv-025941 Ciona savignyi 37.90 1.00e-86 313.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 29.43 1.00e-27 117.00
IUUC-Cne-027057 Cryptococcus neoformans 34.24 7.00e-35 142.00
IUUC-Dre-028484 Danio rerio 71.74 0.00e+00 674.00
IUUC-Dno-028906 Dasypus novemcinctus 97.97 0.00e+00 883.00
IUUC-Dor-030124 Dipodomys ordii 86.56 0.00e+00 753.00
IUUC-Dse-031437 Dothistroma septosporum 28.32 3.00e-26 114.00
IUUC-Dme-031696 Drosophila melanogaster 32.15 2.00e-68 253.00
IUUC-Ete-032573 Echinops telfairi 92.80 0.00e+00 721.00
IUUC-Eca-033711 Equus caballus 98.78 0.00e+00 896.00
IUUC-Eeu-034459 Erinaceus europaeus 72.46 4.00e-77 282.00
IUUC-Fca-035447 Felis catus 95.33 0.00e+00 899.00
IUUC-Fal-036605 Ficedula albicollis 88.50 0.00e+00 786.00
IUUC-Fox-037967 Fusarium oxysporum 27.08 9.00e-19 88.60
IUUC-Fso-038110 Fusarium solani 30.04 2.00e-29 124.00
IUUC-Gmo-038785 Gadus morhua 66.67 0.00e+00 672.00
IUUC-Ggr-039760 Gaeumannomyces graminis 31.05 8.00e-28 119.00
IUUC-Gga-040584 Gallus gallus 92.48 0.00e+00 856.00
IUUC-Gac-042469 Gasterosteus aculeatus 64.19 1.00e-167 582.00
IUUC-Gma-044237 Glycine max 37.43 3.00e-26 112.00
IUUC-Ggo-044498 Gorilla gorilla 83.94 0.00e+00 741.00
IUUC-Hsa-046625 Homo sapiens 97.15 0.00e+00 881.00
IUUC-Hvu-047155 Hordeum vulgare 37.78 2.00e-26 112.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 97.15 0.00e+00 877.00
IUUC-Kpa-049160 Komagataella pastoris 28.72 1.00e-24 108.00
IUUC-Lch-050529 Latimeria chalumnae 78.88 0.00e+00 855.00
IUUC-Lpe-051024 Leersia perrieri 34.84 1.00e-28 120.00
IUUC-Loc-052644 Lepisosteus oculatus 70.20 0.00e+00 670.00
IUUC-Lma-053102 Leptosphaeria maculans 31.75 1.00e-27 118.00
IUUC-Laf-054337 Loxodonta africana 94.72 0.00e+00 864.00
IUUC-Mcc-055659 Macaca mulatta 96.15 4.00e-177 613.00
IUUC-Meu-056084 Macropus eugenii 76.02 4.00e-94 338.00
IUUC-Mor-057255 Magnaporthe oryzae 29.96 3.00e-27 116.00
IUUC-Mpo-057454 Magnaporthe poae 31.05 2.00e-29 124.00
IUUC-Mtr-058098 Medicago truncatula 32.09 8.00e-30 124.00
IUUC-Mla-059068 Melampsora laricipopulina 29.79 1.00e-31 130.00
IUUC-Mga-059624 Meleagris gallopavo 78.55 0.00e+00 836.00
IUUC-Mvi-060282 Microbotryum violaceum 29.14 1.00e-26 115.00
IUUC-Mmr-061142 Microcebus murinus 97.56 0.00e+00 891.00
IUUC-Mdo-062289 Monodelphis domestica 93.09 0.00e+00 899.00
IUUC-Mmu-063961 Mus musculus 96.34 0.00e+00 874.00
IUUC-Mac-065188 Musa acuminata 33.07 1.00e-22 100.00
IUUC-Mpu-066291 Mustela putorius furo 97.56 0.00e+00 891.00
IUUC-Mlu-067431 Myotis lucifugus 93.90 0.00e+00 854.00
IUUC-Nfi-068422 Neosartorya fischeri 30.79 1.00e-30 127.00
IUUC-Ncr-068843 Neurospora crassa 29.89 6.00e-29 122.00
IUUC-Nle-069079 Nomascus leucogenys 96.54 0.00e+00 875.00
IUUC-Opr-070790 Ochotona princeps 94.44 6.00e-57 215.00
IUUC-Ont-071789 Oreochromis niloticus 68.41 3.00e-177 614.00
IUUC-Oan-072946 Ornithorhynchus anatinus 90.47 0.00e+00 822.00
IUUC-Ocu-073816 Oryctolagus cuniculus 98.17 0.00e+00 892.00
IUUC-Oba-075738 Oryza barthii 33.33 2.00e-17 83.60
IUUC-Obr-076355 Oryza brachyantha 38.46 2.00e-27 117.00
IUUC-Ogl-077592 Oryza glaberrima 28.74 2.00e-27 115.00
IUUC-Ogu-078197 Oryza glumaepatula 29.13 4.00e-27 115.00
IUUC-Oin-080047 Oryza indica 37.78 9.00e-26 110.00
IUUC-Olo-080317 Oryza longistaminata 28.74 5.00e-27 114.00
IUUC-Ome-081589 Oryza meridionalis 37.78 3.00e-26 113.00
IUUC-Oni-082700 Oryza nivara 33.71 1.00e-17 84.00
IUUC-Opu-083923 Oryza punctata 34.36 2.00e-21 95.90
IUUC-Oru-084318 Oryza rufipogon 33.71 1.00e-17 84.00
IUUC-Osa-086246 Oryza sativa 38.98 5.00e-06 41.60
IUUC-Ola-086730 Oryzias latipes 56.79 3.00e-150 525.00
IUUC-Olu-087719 Ostreococcus lucimarinus 34.46 1.00e-23 103.00
IUUC-Oga-088992 Otolemur garnettii 85.04 0.00e+00 892.00
IUUC-Oar-089789 Ovis aries 98.17 0.00e+00 894.00
IUUC-Ptr-091636 Pan troglodytes 97.15 0.00e+00 879.00
IUUC-Pan-092911 Papio anubis 96.54 0.00e+00 876.00
IUUC-Psi-093194 Pelodiscus sinensis 79.65 0.00e+00 847.00
IUUC-Pma-094212 Petromyzon marinus 48.80 5.00e-115 407.00
IUUC-Pno-094831 Phaeosphaeria nodorum 29.89 8.00e-28 118.00
IUUC-Ppa-095705 Physcomitrella patens 30.83 2.00e-29 123.00
IUUC-Pfo-096694 Poecilia formosa 65.29 5.00e-180 623.00
IUUC-Pab-097706 Pongo abelii 96.95 0.00e+00 878.00
IUUC-Pop-099891 Populus trichocarpa 32.84 7.00e-26 111.00
IUUC-Pca-100879 Procavia capensis 93.46 6.00e-91 327.00
IUUC-Ppe-101334 Prunus persica 32.17 5.00e-27 115.00
IUUC-Pva-103225 Pteropus vampyrus 82.46 0.00e+00 719.00
IUUC-Pgr-103564 Puccinia graminis 30.38 2.00e-31 130.00
IUUC-Ptt-103802 Puccinia triticina 29.84 6.00e-26 112.00
IUUC-Pte-104345 Pyrenophora teres 30.66 6.00e-28 119.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 30.60 8.00e-29 122.00
IUUC-Rno-106101 Rattus norvegicus 95.93 0.00e+00 872.00
IUUC-Sce-106460 Saccharomyces cerevisiae 30.38 3.00e-25 109.00
IUUC-Sha-106919 Sarcophilus harrisii 80.21 0.00e+00 845.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 32.40 1.00e-30 127.00
IUUC-Spo-108087 Schizosaccharomyces pombe 30.62 5.00e-28 119.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 29.82 1.00e-07 51.60
IUUC-Smo-109411 Selaginella moellendorffii 37.14 2.00e-28 120.00
IUUC-Sit-110678 Setaria italica 37.78 2.00e-26 113.00
IUUC-Sly-111526 Solanum lycopersicum 37.85 1.00e-25 110.00
IUUC-Stu-112494 Solanum tuberosum 38.42 3.00e-26 112.00
IUUC-Sar-112929 Sorex araneus 99.27 2.00e-165 575.00
IUUC-Sbi-114242 Sorghum bicolor 32.94 6.00e-28 118.00
IUUC-Sre-115224 Sporisorium reilianum 31.79 2.00e-30 127.00
IUUC-Tgu-117499 Taeniopygia guttata 89.84 0.00e+00 825.00
IUUC-Tru-118027 Takifugu rubripes 63.02 1.00e-142 499.00
IUUC-Tsy-119462 Tarsius syrichta 97.69 0.00e+00 865.00
IUUC-Tni-120855 Tetraodon nigroviridis 60.36 2.00e-174 604.00
IUUC-Tca-121213 Theobroma cacao 35.45 7.00e-25 108.00
IUUC-Tre-122186 Trichoderma reesei 30.19 6.00e-29 122.00
IUUC-Tvi-122541 Trichoderma virens 27.97 3.00e-29 123.00
IUUC-Tae-123631 Triticum aestivum 38.89 7.00e-27 114.00
IUUC-Tur-126572 Triticum urartu 38.89 2.00e-26 114.00
IUUC-Tme-127023 Tuber melanosporum 32.93 4.00e-32 132.00
IUUC-Tbe-127453 Tupaia belangeri 97.93 0.00e+00 779.00
IUUC-Ttr-128526 Tursiops truncatus 98.58 0.00e+00 892.00
IUUC-Uma-129660 Ustilago maydis 32.56 1.00e-30 128.00
IUUC-Vda-129737 Verticillium dahliae 28.67 1.00e-24 108.00
IUUC-Vpa-130505 Vicugna pacos 91.45 0.00e+00 716.00
IUUC-Vvi-131088 Vitis vinifera 37.08 8.00e-24 104.00
IUUC-Xtr-132799 Xenopus tropicalis 75.61 0.00e+00 741.00
IUUC-Xma-133345 Xiphophorus maculatus 65.88 8.00e-176 609.00
IUUC-Yli-134416 Yarrowia lipolytica 32.12 2.00e-32 133.00
IUUC-Zma-134750 Zea mays 37.78 3.00e-26 112.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved