• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
    • SCOP
  • Disease
    • GWASdb
    • OMIM
  • Drug & target
    • DrugBank
    • Manually
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Oba-075437
Ensembl Protein ID OBART03G39030.1
UniProt Accession A0A0D3FQQ0; A0A0D3FQQ0_9ORYZ
Protein Name NEDD8-activating enzyme E1 regulatory subunit
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
OBART03G39030 OBART03G39030.1 OBART03G39030.1
Status Unreviewed
Classification
Family E-Value Score Start End
E1 3.10e-110 370.2 16 522
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E1

   S: 1    YDRQirlwGeeaqeklksakvllvGagglGcEllKnLvlaGvgsitvvDmdtvevsnlnrqFLfraedvgksKAevaaealkelnpdvnveahe 94
    YDRQ+r+wG+++q++l++a+++l+ +g++G+E KnLvl+Gvgs+tvvD+++ve+s+++++FL++ae g+s+A++++ +l+eln+ vn++++e
   Q: 16 YDRQLRIWGDQGQAALEKASICLLTCGPTGTEAMKNLVLGGVGSVTVVDGSKVEQSDMGNNFLLDAECLGQSRAKSVCSFLQELNDAVNAKFVE 109
    ********************************************************************************************** PP
   S: 95 esiteleeeiv.FfkkfdvVvlaldnrearrkvnrlclnarvpliesgtlGllGqvrviikgltecyscsd...dppqktiPfctlketpn... 181
    es+ +l ++++ Ff++f+vV++++ ++ + +k++++c++a++ l+ ++++Gl G vr+++k++ +++s++d d++++ +P+++lk++
   Q: 110 ESPLALIDTNPsFFSQFTVVIATQLPERSLLKLDDICRKANIVLVAARSYGLTGLVRISVKEHNVIESKPDhflDDLRLHNPWVELKQFAKsid 203
    *****************************************************************************************88899 PP
   S: 182 ......aaehtiewavlfnklleeeageeevlekldseekeegkdkvkselksedeenfeeaieiavkafakttins.ikqllksfecdivtks 268
    +++++++++v++ l+e++a +++++ +++++ek e+k ++++ + + deen++ea+e + k + i++ i+q++++ + ++v++s
   Q: 204 indkdpVVHKHTPYIVILVRLAEKWADAHDGRLPSTRQEKNEFKALIREHMLNLDEENYKEAVESSYKVSVTPGISDeIRQIIDD-SSAEVNSS 296
    999999******************************************************************************9.78899*** PP
   S: 269 kspfwv...........................................................................sfcsnaealq... 284
    +s+fwv +fc+na++l+
   Q: 297 SSDFWVlvaalkefianegngelplegtipdmtslteyyvslqkiyqakaesdclalehhvkdilkridrdpdsisrayikTFCKNARKLRvcr 390
    *******************************************************************************************666 PP
   S: 285 ........vpekvekdeevvkasap.....lylllralerfekkkgrkpgelsfekdddsavdlvtaaanlraeslgiep.kldddlikeiagn 364
    + + + +++++++++ +y+llra++r++++++r pg ++ e d+d +++l+taa + ++++g+++ +l++dli+e++++
   Q: 391 yrsmeeefSSPVLSEVQKYFTDEDYcfamnFYVLLRAVDRLAANYNRFPGIFESEIDED-VPRLKTAAVSV-MSEMGMNGaPLSEDLITEMCRF 482
    666655553355666666667777788888*******************9999999999.*****988875.6********************* PP
   S: 365 iipaiattnavvgGlaaqEviKvvsgkfeplknfflfdae 404
    + ++i++++a++gG+a+qEviK+v+++f+pl +f+f+++
   Q: 483 GGAEIHPVAAFIGGVASQEVIKLVTKQFVPLLGTFIFNGI 522
    *************************************986 PP
   

Organism Oryza barthii
Functional Description
(View)

Functional Description



     Regulatory subunit of the dimeric E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1.
Regulatory subunit of the dimeric E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1.
Protein Sequence
(Fasta)
MAAATAAAFA EPKTKYDRQL RIWGDQGQAA LEKASICLLT CGPTGTEAMK NLVLGGVGSV 60
TVVDGSKVEQ SDMGNNFLLD AECLGQSRAK SVCSFLQELN DAVNAKFVEE SPLALIDTNP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Oba-075437|E1,E1_ThiF|Oryza barthii
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTCCTTGCTC CGCCTCCACT TAGCTTGAGA CCGCTTTATT CCTCGCTCAG GGAGGAGAAG 60
GCGAAGGCGA AGCAAAGCAA AACCTCGGAA GAGCGGCAGA GCCCACTCCA CACGCGGAGA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Oba-075437|E1,E1_ThiF|Oryza barthii
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR030667--APP-BP1
IPR016040--NAD(P)-bd_dom
IPR000594--ThiF_NAD_FAD-bd

Pfam

PF00899--ThiF

Gene Ontology

GO:0019781--F:NEDD8 activating enzyme activity
GO:0045116--P:protein neddylation

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000764 Aegilops tauschii 88.02 0.00e+00 929.00
IUUC-Aml-002333 Ailuropoda melanoleuca 42.97 1.00e-128 452.00
IUUC-Atr-002644 Amborella trichopoda 71.98 0.00e+00 764.00
IUUC-Apl-003446 Anas platyrhynchos 41.92 3.00e-119 421.00
IUUC-Aca-004450 Anolis carolinensis 41.63 4.00e-123 434.00
IUUC-Aly-005466 Arabidopsis lyrata 67.82 0.00e+00 756.00
IUUC-Ath-006692 Arabidopsis thaliana 68.39 0.00e+00 756.00
IUUC-Ago-007900 Ashbya gossypii 27.87 8.00e-41 160.00
IUUC-Acl-008333 Aspergillus clavatus 32.24 4.00e-67 248.00
IUUC-Afl-008529 Aspergillus flavus 32.30 1.00e-71 263.00
IUUC-Afu-009071 Aspergillus fumigatus 31.88 6.00e-66 244.00
IUUC-Ani-009443 Aspergillus nidulans 31.76 4.00e-61 228.00
IUUC-Ang-009669 Aspergillus niger 31.34 5.00e-69 254.00
IUUC-Aor-009914 Aspergillus oryzae 32.01 1.00e-69 256.00
IUUC-Ate-010450 Aspergillus terreus 31.58 1.00e-67 249.00
IUUC-Ame-011183 Astyanax mexicanus 40.65 2.00e-122 432.00
IUUC-Bgr-012111 Blumeria graminis 32.34 1.00e-59 223.00
IUUC-Bta-012583 Bos taurus 43.32 3.00e-130 458.00
IUUC-Bci-013892 Botrytis cinerea 31.49 3.00e-57 215.00
IUUC-Bdi-014592 Brachypodium distachyon 88.68 0.00e+00 937.00
IUUC-Bol-016401 Brassica oleracea 67.82 0.00e+00 754.00
IUUC-Bra-017506 Brassica rapa 66.54 0.00e+00 734.00
IUUC-Cel-018456 Caenorhabditis elegans 30.61 4.00e-72 265.00
IUUC-Cja-020007 Callithrix jacchus 43.45 7.00e-129 453.00
IUUC-Cfa-020324 Canis familiaris 43.13 2.00e-130 458.00
IUUC-Cpo-022248 Cavia porcellus 40.17 4.00e-69 254.00
IUUC-Csa-023149 Chlorocebus sabaeus 40.73 7.00e-103 367.00
IUUC-Cho-024537 Choloepus hoffmanni 35.78 1.00e-87 316.00
IUUC-Cin-025763 Ciona intestinalis 41.33 4.00e-111 394.00
IUUC-Csv-026113 Ciona savignyi 39.18 2.00e-102 365.00
IUUC-Cgl-026428 Colletotrichum gloeosporioides 29.89 1.00e-56 213.00
IUUC-Cne-026884 Cryptococcus neoformans 31.07 1.00e-64 239.00
IUUC-Dre-028140 Danio rerio 41.57 7.00e-126 443.00
IUUC-Dno-030033 Dasypus novemcinctus 42.83 5.00e-112 397.00
IUUC-Dor-030513 Dipodomys ordii 36.51 6.00e-38 150.00
IUUC-Dse-031536 Dothistroma septosporum 30.20 2.00e-61 229.00
IUUC-Dme-031683 Drosophila melanogaster 38.90 4.00e-97 348.00
IUUC-Ete-032420 Echinops telfairi 38.27 6.00e-110 390.00
IUUC-Eca-033992 Equus caballus 41.22 1.00e-100 359.00
IUUC-Eeu-034713 Erinaceus europaeus 33.19 2.00e-36 146.00
IUUC-Fca-036548 Felis catus 42.75 1.00e-129 456.00
IUUC-Fal-037600 Ficedula albicollis 41.52 1.00e-116 412.00
IUUC-Fox-038037 Fusarium oxysporum 31.86 9.00e-68 250.00
IUUC-Fso-038387 Fusarium solani 32.25 2.00e-67 249.00
IUUC-Gmo-038562 Gadus morhua 40.72 1.00e-118 419.00
IUUC-Ggr-040005 Gaeumannomyces graminis 31.68 6.00e-64 237.00
IUUC-Gga-041129 Gallus gallus 41.98 4.00e-120 424.00
IUUC-Gac-042558 Gasterosteus aculeatus 41.25 6.00e-123 433.00
IUUC-Gma-043610 Glycine max 70.25 0.00e+00 754.00
IUUC-Ggo-045611 Gorilla gorilla 42.88 7.00e-128 450.00
IUUC-Hsa-046563 Homo sapiens 43.13 3.00e-129 454.00
IUUC-Hvu-047790 Hordeum vulgare 88.43 0.00e+00 685.00
IUUC-Itr-048066 Ictidomys tridecemlineatus 43.51 5.00e-129 454.00
IUUC-Kpa-049309 Komagataella pastoris 35.32 9.00e-77 280.00
IUUC-Lch-050038 Latimeria chalumnae 42.13 7.00e-123 433.00
IUUC-Lpe-051535 Leersia perrieri 91.30 0.00e+00 883.00
IUUC-Loc-051917 Lepisosteus oculatus 38.29 1.00e-106 380.00
IUUC-Lma-053112 Leptosphaeria maculans 32.55 3.00e-69 255.00
IUUC-Laf-053690 Loxodonta africana 43.89 1.00e-131 462.00
IUUC-Mcc-055117 Macaca mulatta 42.80 7.00e-127 446.00
IUUC-Meu-056761 Macropus eugenii 35.55 2.00e-93 335.00
IUUC-Mor-057230 Magnaporthe oryzae 31.31 2.00e-67 249.00
IUUC-Mpo-057514 Magnaporthe poae 31.31 7.00e-60 224.00
IUUC-Mtr-058551 Medicago truncatula 67.04 0.00e+00 728.00
IUUC-Mla-059183 Melampsora laricipopulina 34.38 5.00e-87 314.00
IUUC-Mga-060144 Meleagris gallopavo 41.27 2.00e-116 412.00
IUUC-Mvi-060221 Microbotryum violaceum 34.01 6.00e-60 224.00
IUUC-Mmr-061325 Microcebus murinus 42.31 5.00e-126 444.00
IUUC-Mdo-062532 Monodelphis domestica 42.94 3.00e-128 451.00
IUUC-Mmu-063956 Mus musculus 42.56 2.00e-128 451.00
IUUC-Mac-064521 Musa acuminata 73.60 0.00e+00 806.00
IUUC-Mpu-066716 Mustela putorius furo 43.29 8.00e-121 426.00
IUUC-Mlu-067459 Myotis lucifugus 43.62 8.00e-131 459.00
IUUC-Nfi-068245 Neosartorya fischeri 32.24 4.00e-67 248.00
IUUC-Ncr-068910 Neurospora crassa 30.80 8.00e-63 234.00
IUUC-Nle-070034 Nomascus leucogenys 41.54 9.00e-122 429.00
IUUC-Opr-070552 Ochotona princeps 39.31 1.00e-98 352.00
IUUC-Ont-071426 Oreochromis niloticus 41.44 5.00e-125 440.00
IUUC-Oan-073389 Ornithorhynchus anatinus 39.19 4.00e-88 317.00
IUUC-Ocu-074911 Oryctolagus cuniculus 43.70 9.00e-131 459.00
IUUC-Obr-076684 Oryza brachyantha 94.03 0.00e+00 899.00
IUUC-Ogl-077170 Oryza glaberrima 100.00 0.00e+00 1008.00
IUUC-Ogu-078844 Oryza glumaepatula 98.79 0.00e+00 946.00
IUUC-Oin-079105 Oryza indica 99.81 0.00e+00 1004.00
IUUC-Olo-080943 Oryza longistaminata 96.56 0.00e+00 919.00
IUUC-Oni-082891 Oryza nivara 96.74 0.00e+00 970.00
IUUC-Opu-083457 Oryza punctata 98.85 0.00e+00 995.00
IUUC-Oru-084960 Oryza rufipogon 96.56 0.00e+00 919.00
IUUC-Osa-085358 Oryza sativa 99.42 0.00e+00 999.00
IUUC-Ola-086420 Oryzias latipes 39.36 8.00e-78 283.00
IUUC-Olu-087625 Ostreococcus lucimarinus 30.45 1.00e-59 223.00
IUUC-Oga-088810 Otolemur garnettii 43.32 1.00e-129 455.00
IUUC-Oar-089196 Ovis aries 43.07 2.00e-128 452.00
IUUC-Ptr-090617 Pan troglodytes 43.13 2.00e-129 455.00
IUUC-Pan-092761 Papio anubis 43.32 2.00e-130 458.00
IUUC-Psi-093191 Pelodiscus sinensis 40.00 5.00e-121 427.00
IUUC-Pma-094380 Petromyzon marinus 40.64 1.00e-109 389.00
IUUC-Pno-095084 Phaeosphaeria nodorum 31.11 5.00e-61 229.00
IUUC-Ppa-095798 Physcomitrella patens 55.53 4.00e-175 607.00
IUUC-Pfo-096467 Poecilia formosa 41.40 3.00e-120 425.00
IUUC-Pab-098255 Pongo abelii 44.80 7.00e-108 383.00
IUUC-Pop-099722 Populus trichocarpa 71.02 0.00e+00 787.00
IUUC-Pca-100807 Procavia capensis 52.41 2.00e-53 202.00
IUUC-Ppe-101280 Prunus persica 70.25 0.00e+00 776.00
IUUC-Pva-102333 Pteropus vampyrus 41.75 7.00e-123 433.00
IUUC-Pgr-103401 Puccinia graminis 30.02 7.00e-69 254.00
IUUC-Ptt-103889 Puccinia triticina 27.26 1.00e-60 226.00
IUUC-Pte-104355 Pyrenophora teres 32.13 7.00e-67 247.00
IUUC-Pyt-104545 Pyrenophora triticirepentis 32.73 5.00e-68 251.00
IUUC-Rno-105810 Rattus norvegicus 42.37 1.00e-126 446.00
IUUC-Sce-106397 Saccharomyces cerevisiae 27.24 1.00e-33 137.00
IUUC-Sha-106770 Sarcophilus harrisii 49.23 3.00e-71 261.00
IUUC-Sja-107926 Schizosaccharomyces japonicus 33.14 4.00e-78 284.00
IUUC-Spo-108276 Schizosaccharomyces pombe 33.91 1.00e-82 300.00
IUUC-Ssl-108387 Sclerotinia sclerotiorum 32.36 2.00e-59 223.00
IUUC-Smo-109296 Selaginella moellendorffii 54.72 1.00e-167 582.00
IUUC-Sit-110157 Setaria italica 88.48 0.00e+00 951.00
IUUC-Sly-111105 Solanum lycopersicum 67.48 0.00e+00 748.00
IUUC-Stu-112469 Solanum tuberosum 68.41 0.00e+00 763.00
IUUC-Sar-113083 Sorex araneus 33.85 7.00e-87 313.00
IUUC-Sbi-113813 Sorghum bicolor 89.25 0.00e+00 959.00
IUUC-Sre-115058 Sporisorium reilianum 33.63 2.00e-64 239.00
IUUC-Tgu-116772 Taeniopygia guttata 42.13 1.00e-116 412.00
IUUC-Tru-118686 Takifugu rubripes 40.49 5.00e-123 434.00
IUUC-Tsy-119111 Tarsius syrichta 45.25 9.00e-63 233.00
IUUC-Tni-120231 Tetraodon nigroviridis 39.43 2.00e-109 388.00
IUUC-Tca-121491 Theobroma cacao 70.44 0.00e+00 745.00
IUUC-Tre-122103 Trichoderma reesei 32.65 1.00e-71 263.00
IUUC-Tvi-122672 Trichoderma virens 31.58 7.00e-67 247.00
IUUC-Tae-125316 Triticum aestivum 88.87 0.00e+00 935.00
IUUC-Tur-126487 Triticum urartu 87.43 0.00e+00 907.00
IUUC-Tme-127097 Tuber melanosporum 34.24 2.00e-78 285.00
IUUC-Ttr-128465 Tursiops truncatus 40.04 1.00e-113 402.00
IUUC-Uma-129645 Ustilago maydis 29.01 1.00e-65 243.00
IUUC-Vda-129989 Verticillium dahliae 29.26 3.00e-49 188.00
IUUC-Vpa-130529 Vicugna pacos 40.99 7.00e-119 420.00
IUUC-Vvi-131059 Vitis vinifera 71.59 0.00e+00 786.00
IUUC-Xtr-132002 Xenopus tropicalis 43.16 2.00e-126 445.00
IUUC-Xma-133930 Xiphophorus maculatus 41.71 5.00e-124 437.00
IUUC-Yli-134505 Yarrowia lipolytica 34.17 9.00e-80 290.00
IUUC-Zma-135895 Zea mays 87.14 0.00e+00 941.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved