• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • AREsite
    • microRNA
    • TRANSFAC
    • RepTar
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • Mentha
  • PTM
    • CPLM
    • PhosphositePlus
    • mUbiSiDa
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Mvi-060330
Ensembl Protein ID MVLG_00935T0
UniProt Accession U5H0K4; U5H0K4_USTV1
Genbank Protein ID KDE08831.1
Protein Name Ubiquitin-conjugating enzyme E2 2
Genbank Nucleotide ID AEIJ01000082
Gene Name MVLG_00935
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
MVLG_00935 MVLG_00935T0 MVLG_00935T0
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 9.10e-51 169.9 8 142
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000256|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspals 97
    Rl +++k+l++dpp gis +p + +++ w+++i+Gp++tp+e+g+F+l ++f+e+YP kPP+vkf++k+fhPnvy++G++Cl+il+ ++Wsp+++
   Q: 8 RLVRDFKALSTDPPGGISGSPCAD-NIMVWNAVIFGPAETPFEDGTFRLALSFDESYPNKPPTVKFVSKMFHPNVYASGELCLDILQ--NRWSPTYD 101
    899*********************.9************************************************************9..******** PP
   S: 98 vesvllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    v+ +l+s+qsll++pnp+sp+n+eaa+l+++n +ey k+vr
   Q: 102 VAAILTSVQSLLNDPNPNSPANAEAAQLFRENMKEYVKRVR 142
    ***************************************98 PP
   

Organism Microbotryum violaceum
Protein Sequence
(Fasta)
MSTPARRRLV RDFKALSTDP PGGISGSPCA DNIMVWNAVI FGPAETPFED GTFRLALSFD 60
ESYPNKPPTV KFVSKMFHPN VYASGELCLD ILQNRWSPTY DVAAILTSVQ SLLNDPNPNS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mvi-060330|E2,E2/UBC|Microbotryum violaceum
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CGTAGTCGCT CTGGGCTCTG ATCATGTCGA CGCCCGCACG AAGGAGATTG GGTAAGTACT 60
CTTCTCGGAC CTTCCTCTGT GCATCTGCCT CTGGCTCGCT CCGATCGAGT CACCTCCACC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mvi-060330|E2,E2/UBC|Microbotryum violaceum
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0000781--C:chromosome, telomeric region
GO:0005829--C:cytosol
GO:0033503--C:HULC complex
GO:1990304--C:MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:0000790--C:nuclear chromatin
GO:0000502--C:proteasome complex
GO:0097505--C:Rad6-Rad18 complex
GO:0005524--F:ATP binding
GO:0003697--F:single-stranded DNA binding
GO:0043142--F:single-stranded DNA-dependent ATPase activity
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0071455--P:cellular response to hyperoxia
GO:0031497--P:chromatin assembly
GO:0006348--P:chromatin silencing at telomere
GO:0006353--P:DNA-templated transcription, termination
GO:0000724--P:double-strand break repair via homologous recombination
GO:0042275--P:error-free postreplication DNA repair
GO:0070987--P:error-free translesion synthesis
GO:0042276--P:error-prone translesion synthesis
GO:0071894--P:histone H2B conserved C-terminal lysine ubiquitination
GO:0010390--P:histone monoubiquitination
GO:0042138--P:meiotic DNA double-strand break formation
GO:0031571--P:mitotic G1 DNA damage checkpoint
GO:0061186--P:negative regulation of chromatin silencing at silent mating-type cassette
GO:0031939--P:negative regulation of chromatin silencing at telomere
GO:1901487--P:negative regulation of SREBP signaling pathway by positive regulation of transcription factor catabolic process in response to increased oxygen levels
GO:0010620--P:negative regulation of transcription by transcription factor catabolism
GO:1990920--P:proteasome localization to nuclear periphery
GO:0070534--P:protein K63-linked ubiquitination
GO:1901044--P:protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
GO:0090089--P:regulation of dipeptide transport
GO:0051569--P:regulation of histone H3-K4 methylation
GO:0000722--P:telomere maintenance via recombination
GO:0006366--P:transcription from RNA polymerase II promoter
GO:0071629--P:ubiquitin-dependent catabolism of misfolded proteins by cytoplasm-associated proteasome
GO:0030433--P:ubiquitin-dependent ERAD pathway
GO:0071596--P:ubiquitin-dependent protein catabolic process via the N-end rule pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001001 Aegilops tauschii 68.42 2.00e-63 232.00
IUUC-Aml-002120 Ailuropoda melanoleuca 72.85 1.00e-66 243.00
IUUC-Atr-002862 Amborella trichopoda 71.05 2.00e-64 236.00
IUUC-Apl-004063 Anas platyrhynchos 65.99 5.00e-56 207.00
IUUC-Aca-005001 Anolis carolinensis 72.85 1.00e-66 243.00
IUUC-Aly-006336 Arabidopsis lyrata 70.39 1.00e-58 216.00
IUUC-Ath-007547 Arabidopsis thaliana 70.39 1.00e-58 216.00
IUUC-Ago-007745 Ashbya gossypii 73.15 3.00e-66 242.00
IUUC-Acl-008139 Aspergillus clavatus 75.50 7.00e-70 253.00
IUUC-Afl-008551 Aspergillus flavus 75.50 4.00e-70 254.00
IUUC-Afu-008980 Aspergillus fumigatus 75.50 4.00e-70 254.00
IUUC-Ang-009554 Aspergillus niger 75.50 4.00e-70 254.00
IUUC-Aor-010242 Aspergillus oryzae 75.50 4.00e-70 254.00
IUUC-Ate-010390 Aspergillus terreus 75.50 4.00e-70 254.00
IUUC-Ame-011594 Astyanax mexicanus 74.17 5.00e-68 248.00
IUUC-Bgr-012039 Blumeria graminis 74.26 6.00e-63 230.00
IUUC-Bta-012840 Bos taurus 72.85 1.00e-66 243.00
IUUC-Bci-013919 Botrytis cinerea 74.34 4.00e-70 254.00
IUUC-Bdi-014308 Brachypodium distachyon 71.05 3.00e-64 235.00
IUUC-Bol-016245 Brassica oleracea 69.74 2.00e-64 235.00
IUUC-Bra-016803 Brassica rapa 70.39 1.00e-58 216.00
IUUC-Cel-018244 Caenorhabditis elegans 72.85 9.00e-69 250.00
IUUC-Cja-018783 Callithrix jacchus 74.17 5.00e-68 248.00
IUUC-Cfa-020646 Canis familiaris 74.17 9.00e-68 247.00
IUUC-Cpo-021323 Cavia porcellus 73.51 7.00e-68 247.00
IUUC-Cre-022822 Chlamydomonas reinhardtii 69.08 4.00e-56 208.00
IUUC-Csa-023588 Chlorocebus sabaeus 74.17 5.00e-68 248.00
IUUC-Cho-024773 Choloepus hoffmanni 57.62 6.00e-47 177.00
IUUC-Cin-025537 Ciona intestinalis 70.20 4.00e-53 198.00
IUUC-Csv-025846 Ciona savignyi 70.47 7.00e-56 207.00
IUUC-Cgl-026381 Colletotrichum gloeosporioides 74.83 2.00e-69 252.00
IUUC-Cne-026864 Cryptococcus neoformans 79.19 2.00e-70 256.00
IUUC-Cme-027284 Cyanidioschyzon merolae 63.58 7.00e-49 185.00
IUUC-Dre-028358 Danio rerio 74.17 5.00e-68 248.00
IUUC-Dno-029661 Dasypus novemcinctus 72.85 1.00e-66 243.00
IUUC-Dor-030452 Dipodomys ordii 71.32 8.00e-59 216.00
IUUC-Dse-031487 Dothistroma septosporum 74.83 2.00e-69 252.00
IUUC-Dme-031863 Drosophila melanogaster 73.51 2.00e-67 245.00
IUUC-Ete-032595 Echinops telfairi 71.81 3.00e-65 238.00
IUUC-Eca-033377 Equus caballus 72.85 1.00e-66 243.00
IUUC-Eeu-035191 Erinaceus europaeus 58.17 4.00e-47 178.00
IUUC-Fca-036581 Felis catus 74.17 5.00e-68 248.00
IUUC-Fal-037474 Ficedula albicollis 75.42 3.00e-53 198.00
IUUC-Fox-037808 Fusarium oxysporum 74.83 2.00e-69 252.00
IUUC-Fso-038232 Fusarium solani 74.83 3.00e-69 251.00
IUUC-Gmo-038517 Gadus morhua 74.17 5.00e-68 248.00
IUUC-Ggr-039875 Gaeumannomyces graminis 73.86 2.00e-69 252.00
IUUC-Gga-040588 Gallus gallus 74.17 5.00e-68 248.00
IUUC-Gac-042471 Gasterosteus aculeatus 73.51 2.00e-67 246.00
IUUC-Gma-043883 Glycine max 71.05 1.00e-64 236.00
IUUC-Ggo-044896 Gorilla gorilla 74.17 5.00e-68 248.00
IUUC-Hsa-046383 Homo sapiens 74.17 5.00e-68 248.00
IUUC-Hvu-047054 Hordeum vulgare 68.42 2.00e-63 232.00
IUUC-Itr-048507 Ictidomys tridecemlineatus 74.17 5.00e-68 248.00
IUUC-Kpa-049225 Komagataella pastoris 72.48 5.00e-67 244.00
IUUC-Lch-049964 Latimeria chalumnae 74.17 5.00e-68 248.00
IUUC-Lpe-051301 Leersia perrieri 71.05 1.00e-64 236.00
IUUC-Loc-051731 Lepisosteus oculatus 74.17 5.00e-68 248.00
IUUC-Lma-053016 Leptosphaeria maculans 83.33 3.00e-26 107.00
IUUC-Laf-053680 Loxodonta africana 74.17 5.00e-68 248.00
IUUC-Mcc-055546 Macaca mulatta 74.17 1.00e-67 247.00
IUUC-Meu-056231 Macropus eugenii 74.17 5.00e-68 248.00
IUUC-Mor-057087 Magnaporthe oryzae 74.10 2.00e-63 232.00
IUUC-Mpo-057498 Magnaporthe poae 73.86 2.00e-69 253.00
IUUC-Mtr-058612 Medicago truncatula 71.05 1.00e-57 213.00
IUUC-Mla-058876 Melampsora laricipopulina 84.21 7.00e-70 254.00
IUUC-Mga-059863 Meleagris gallopavo 71.32 8.00e-59 217.00
IUUC-Mmr-060630 Microcebus murinus 72.85 1.00e-66 243.00
IUUC-Mdo-062292 Monodelphis domestica 74.17 5.00e-68 248.00
IUUC-Mmu-063680 Mus musculus 74.17 5.00e-68 248.00
IUUC-Mac-064774 Musa acuminata 69.74 4.00e-64 234.00
IUUC-Mpu-065803 Mustela putorius furo 72.85 1.00e-66 243.00
IUUC-Mlu-067147 Myotis lucifugus 72.85 1.00e-66 243.00
IUUC-Nfi-068580 Neosartorya fischeri 75.50 4.00e-70 254.00
IUUC-Ncr-068913 Neurospora crassa 74.83 5.00e-69 251.00
IUUC-Nle-069121 Nomascus leucogenys 74.17 5.00e-68 248.00
IUUC-Opr-070935 Ochotona princeps 72.85 1.00e-66 243.00
IUUC-Ont-071335 Oreochromis niloticus 74.17 6.00e-68 247.00
IUUC-Oan-072706 Ornithorhynchus anatinus 66.89 1.00e-59 219.00
IUUC-Ocu-074550 Oryctolagus cuniculus 74.17 1.00e-67 247.00
IUUC-Oba-075847 Oryza barthii 71.05 6.00e-64 235.00
IUUC-Obr-076713 Oryza brachyantha 71.05 1.00e-64 236.00
IUUC-Ogl-077116 Oryza glaberrima 71.05 1.00e-64 236.00
IUUC-Ogu-078696 Oryza glumaepatula 71.05 1.00e-64 236.00
IUUC-Oin-079099 Oryza indica 71.05 1.00e-64 236.00
IUUC-Olo-081018 Oryza longistaminata 61.21 5.00e-55 205.00
IUUC-Ome-081285 Oryza meridionalis 71.05 1.00e-64 236.00
IUUC-Oni-082088 Oryza nivara 71.05 1.00e-64 236.00
IUUC-Opu-083310 Oryza punctata 71.05 1.00e-64 236.00
IUUC-Oru-084449 Oryza rufipogon 71.05 1.00e-64 236.00
IUUC-Osa-085923 Oryza sativa 71.05 1.00e-64 236.00
IUUC-Ola-086407 Oryzias latipes 74.17 5.00e-68 248.00
IUUC-Olu-087830 Ostreococcus lucimarinus 69.80 3.00e-53 198.00
IUUC-Oga-088659 Otolemur garnettii 74.17 5.00e-68 248.00
IUUC-Oar-090141 Ovis aries 72.85 1.00e-66 243.00
IUUC-Ptr-091305 Pan troglodytes 74.17 5.00e-68 248.00
IUUC-Pan-092740 Papio anubis 74.17 1.00e-67 247.00
IUUC-Psi-094094 Pelodiscus sinensis 74.17 5.00e-68 248.00
IUUC-Pma-094376 Petromyzon marinus 74.17 1.00e-67 246.00
IUUC-Pno-094935 Phaeosphaeria nodorum 75.50 5.00e-70 254.00
IUUC-Ppa-095689 Physcomitrella patens 74.80 5.00e-56 207.00
IUUC-Pfo-096656 Poecilia formosa 73.51 7.00e-68 247.00
IUUC-Pab-097972 Pongo abelii 74.17 5.00e-68 248.00
IUUC-Pop-099517 Populus trichocarpa 71.05 1.00e-64 236.00
IUUC-Pca-100906 Procavia capensis 68.87 1.00e-61 226.00
IUUC-Ppe-101594 Prunus persica 71.05 1.00e-64 236.00
IUUC-Pva-102380 Pteropus vampyrus 73.51 3.00e-66 241.00
IUUC-Pgr-103611 Puccinia graminis 83.87 1.00e-70 256.00
IUUC-Ptt-103971 Puccinia triticina 86.89 4.00e-54 201.00
IUUC-Pte-104378 Pyrenophora teres 76.16 2.00e-70 255.00
IUUC-Pyt-104757 Pyrenophora triticirepentis 76.16 2.00e-70 255.00
IUUC-Rno-105772 Rattus norvegicus 72.85 6.00e-67 244.00
IUUC-Sce-106283 Saccharomyces cerevisiae 73.15 3.00e-66 242.00
IUUC-Sha-107650 Sarcophilus harrisii 72.19 2.00e-65 239.00
IUUC-Sja-107790 Schizosaccharomyces japonicus 79.87 4.00e-63 231.00
IUUC-Spo-108073 Schizosaccharomyces pombe 80.54 3.00e-63 231.00
IUUC-Ssl-108432 Sclerotinia sclerotiorum 74.34 4.00e-70 254.00
IUUC-Smo-109036 Selaginella moellendorffii 71.14 5.00e-64 234.00
IUUC-Sit-110731 Setaria italica 71.05 1.00e-64 236.00
IUUC-Sly-111506 Solanum lycopersicum 71.05 1.00e-64 236.00
IUUC-Stu-112080 Solanum tuberosum 71.05 1.00e-64 236.00
IUUC-Sar-113429 Sorex araneus 72.85 1.00e-66 243.00
IUUC-Sbi-114289 Sorghum bicolor 71.05 1.00e-64 236.00
IUUC-Sre-115106 Sporisorium reilianum 84.52 1.00e-72 263.00
IUUC-Ssc-116265 Sus scrofa 74.17 5.00e-68 248.00
IUUC-Tgu-117383 Taeniopygia guttata 74.17 5.00e-68 248.00
IUUC-Tru-118576 Takifugu rubripes 72.85 2.00e-67 246.00
IUUC-Tsy-119000 Tarsius syrichta 72.85 1.00e-66 243.00
IUUC-Tni-119745 Tetraodon nigroviridis 72.85 3.00e-67 245.00
IUUC-Tca-121827 Theobroma cacao 70.39 2.00e-64 236.00
IUUC-Tre-122002 Trichoderma reesei 74.83 3.00e-69 251.00
IUUC-Tvi-122331 Trichoderma virens 74.83 3.00e-69 251.00
IUUC-Tae-125400 Triticum aestivum 71.05 2.00e-64 235.00
IUUC-Tur-126866 Triticum urartu 69.74 6.00e-64 234.00
IUUC-Tme-127148 Tuber melanosporum 75.17 2.00e-69 252.00
IUUC-Tbe-127921 Tupaia belangeri 70.86 2.00e-62 229.00
IUUC-Ttr-129050 Tursiops truncatus 74.17 6.00e-67 244.00
IUUC-Uma-129561 Ustilago maydis 84.52 8.00e-73 264.00
IUUC-Vda-129711 Verticillium dahliae 74.83 2.00e-69 252.00
IUUC-Vpa-130570 Vicugna pacos 66.18 3.00e-53 198.00
IUUC-Vvi-131108 Vitis vinifera 71.05 8.00e-65 237.00
IUUC-Xtr-132301 Xenopus tropicalis 74.17 5.00e-68 248.00
IUUC-Xma-133937 Xiphophorus maculatus 74.17 5.00e-68 248.00
IUUC-Yli-134660 Yarrowia lipolytica 76.16 6.00e-70 254.00
IUUC-Zma-135584 Zea mays 70.39 3.00e-64 235.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved