• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • circBase
    • microRNA
    • TRANSFAC
    • RepTar
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • Mentha
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Aly-005473
UUCD1 version UUC-ArL-00998
Ensembl Protein ID scaffold_403582.1
UniProt Accession D7LDY2; D7LDY2_ARALL
Genbank Protein ID EFH58315.1
Protein Name Eukaryotic translation initiation factor 3 subunit I
Genbank Nucleotide ID GL348716
Gene Name TRIP-1; ARALYDRAFT_904081
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
scaffold_403582.1 scaffold_403582.1 scaffold_403582.1
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/DCX/DWD 3.60e-27 93.9 50 87
UBD/Beta-Prp 3.20e-54 184.8 6 233
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/DCX/DWD

   S: 1    gHtdsvtclaf.sd.tllvsGsdDgtikvWDlrtgvll 36
    gH++ v+c++ d +l++Gs D t k+WD+++g+ l
   Q: 50 GHNGAVWCCDVsRDsSRLITGSADQTAKLWDVKSGKEL 87
    8***********77799****************99875 PP
   


   UBD/Beta-Prp

   S: 48   lsgheaevtavkfspdgkilvtgseDrtikvwdlstgkcvhtlkghedsvlslsfspsgdklvsGshdrtirvwdletgqclee........ 131
    ++ghe + t +++++dg++l ++++D+t +w ++g+ + t++gh+ v+++++s+++++l++Gs+d+t+++wd+++g++l +
   Q: 6 MKGHERPLTFLRYNKDGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVKSGKELFTfkfgsptr 97
    489*******************************************************************************99******** PP
   S: 132 ..............................................tlsghdgvvncvvvhpdgnllvsGslDrtvrlWdlktgkllrtl.. 175
    + +g++ +n +v+ p ++ +vs++ D+++r+Wd +tgkll +
   Q: 98 svdfalgdhlavittdhfvdrmaaihvkriaedpedqvsdsvlvlqCPDGKK-RINRAVWGPLNQTIVSAGEDTVIRIWDTETGKLLNETne 188
    *******************************************987777766.6788899999************************99989 PP
   S: 176 tgghtdsvyslsfdsngkelvsgsldgtvklwdlqtgecvrtlng 220
    + gh+++++sl + ++++gs+d+t klwd++t + ++t++
   Q: 189 EVGHKKAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTT 233
    667***********************************9999985 PP
   

Organism Arabidopsis lyrata
Functional Description
(View)

Functional Description



     Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.
Protein Sequence
(Fasta)
MRPILMKGHE RPLTFLRYNK DGDLLFSCAK DHTPTLWFAD NGERLGTYRG HNGAVWCCDV 60
SRDSSRLITG SADQTAKLWD VKSGKELFTF KFGSPTRSVD FALGDHLAVI TTDHFVDRMA 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Aly-005473|E3,WD_repeat;UBD,Beta-Prp|Arabidopsis lyrata
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CAAACCCTAG GAAATTGAAG ATGAGGCCGA TTTTGATGAA GGGACATGAA CGTCCATTGA 60
CGTTCCTGAG GTACAACAAA GATGGCGATC TACTTTTCTC CTGCGCCAAG GATCACACTC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Aly-005473|E3,WD_repeat;UBD,Beta-Prp|Arabidopsis lyrata
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0396--Initiation factor
KW-0648--Protein biosynthesis
KW-1185--Reference proteome
KW-0677--Repeat
KW-0853--WD repeat

Interpro

IPR011042--6-blade_b-propeller_TolB-like
IPR027525--eIF3i
IPR020472--G-protein_beta_WD-40_rep
IPR015943--WD40/YVTN_repeat-like_dom
IPR001680--WD40_repeat
IPR019775--WD40_repeat_CS
IPR017986--WD40_repeat_dom

PROSITE

PS00678--WD_REPEATS_1
PS50082--WD_REPEATS_2
PS50294--WD_REPEATS_REGION

Pfam

PF00400--WD40

PRINTS

PR00320--GPROTEINBRPT

SMART

SM00320--WD40

Gene Ontology

GO:0080008--C:Cul4-RING E3 ubiquitin ligase complex
GO:0005829--C:cytosol
GO:0016282--C:eukaryotic 43S preinitiation complex
GO:0033290--C:eukaryotic 48S preinitiation complex
GO:0005852--C:eukaryotic translation initiation factor 3 complex
GO:0003743--F:translation initiation factor activity
GO:0001731--P:formation of translation preinitiation complex
GO:0006446--P:regulation of translational initiation
GO:0046686--P:response to cadmium ion
GO:0009651--P:response to salt stress

KEGG aly:ARALYDRAFT_904081
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000115 Aegilops tauschii 42.07 6.00e-54 204.00
IUUC-Aml-001321 Ailuropoda melanoleuca 44.51 2.00e-82 298.00
IUUC-Atr-002468 Amborella trichopoda 73.53 2.00e-87 314.00
IUUC-Apl-003841 Anas platyrhynchos 44.82 2.00e-84 304.00
IUUC-Aca-005123 Anolis carolinensis 44.51 5.00e-85 306.00
IUUC-Ago-008000 Ashbya gossypii 41.27 3.00e-73 268.00
IUUC-Acl-008098 Aspergillus clavatus 42.64 2.00e-74 271.00
IUUC-Afl-008494 Aspergillus flavus 43.77 9.00e-78 282.00
IUUC-Afu-009080 Aspergillus fumigatus 42.34 2.00e-73 268.00
IUUC-Ani-009230 Aspergillus nidulans 43.77 2.00e-76 278.00
IUUC-Aor-010114 Aspergillus oryzae 43.77 9.00e-78 282.00
IUUC-Ate-010285 Aspergillus terreus 42.86 2.00e-76 278.00
IUUC-Bgr-012121 Blumeria graminis 41.72 4.00e-71 260.00
IUUC-Bta-013143 Bos taurus 44.82 5.00e-83 300.00
IUUC-Bdi-015019 Brachypodium distachyon 77.74 3.00e-152 530.00
IUUC-Bol-015709 Brassica oleracea 86.36 1.00e-174 605.00
IUUC-Bra-017760 Brassica rapa 86.36 4.00e-176 610.00
IUUC-Cel-018226 Caenorhabditis elegans 37.96 6.00e-67 246.00
IUUC-Cja-019741 Callithrix jacchus 45.12 2.00e-83 301.00
IUUC-Cfa-021204 Canis familiaris 44.82 1.00e-82 298.00
IUUC-Cpo-021661 Cavia porcellus 44.21 3.00e-82 297.00
IUUC-Cre-022952 Chlamydomonas reinhardtii 51.52 1.00e-101 362.00
IUUC-Csa-024038 Chlorocebus sabaeus 45.12 2.00e-83 301.00
IUUC-Cgl-026583 Colletotrichum gloeosporioides 44.82 2.00e-77 281.00
IUUC-Cne-026838 Cryptococcus neoformans 40.79 3.00e-76 278.00
IUUC-Cme-027304 Cyanidioschyzon merolae 51.38 6.00e-85 306.00
IUUC-Dno-029171 Dasypus novemcinctus 44.65 8.00e-82 296.00
IUUC-Dse-031191 Dothistroma septosporum 46.39 6.00e-81 293.00
IUUC-Eca-033259 Equus caballus 44.82 2.00e-82 298.00
IUUC-Eeu-035153 Erinaceus europaeus 40.00 2.00e-23 102.00
IUUC-Fca-036489 Felis catus 44.82 2.00e-82 298.00
IUUC-Fal-037485 Ficedula albicollis 44.51 4.00e-84 303.00
IUUC-Fox-037860 Fusarium oxysporum 44.82 4.00e-77 280.00
IUUC-Fso-038188 Fusarium solani 43.60 2.00e-74 272.00
IUUC-Ggr-040045 Gaeumannomyces graminis 42.33 7.00e-75 273.00
IUUC-Gga-040645 Gallus gallus 44.35 5.00e-83 300.00
IUUC-Gma-043246 Glycine max 82.32 3.00e-164 570.00
IUUC-Ggo-045578 Gorilla gorilla 45.12 2.00e-83 301.00
IUUC-Hsa-046734 Homo sapiens 45.12 2.00e-83 301.00
IUUC-Hvu-047553 Hordeum vulgare 77.13 5.00e-152 529.00
IUUC-Itr-048467 Ictidomys tridecemlineatus 44.82 2.00e-82 298.00
IUUC-Lch-049620 Latimeria chalumnae 44.88 3.00e-76 277.00
IUUC-Lpe-051338 Leersia perrieri 76.04 2.00e-142 497.00
IUUC-Lma-053047 Leptosphaeria maculans 47.40 3.00e-84 304.00
IUUC-Laf-053801 Loxodonta africana 44.55 9.00e-80 289.00
IUUC-Mcc-055498 Macaca mulatta 40.55 3.00e-65 241.00
IUUC-Meu-056729 Macropus eugenii 40.85 4.00e-74 270.00
IUUC-Mor-057025 Magnaporthe oryzae 42.99 2.00e-74 272.00
IUUC-Mpo-057511 Magnaporthe poae 44.21 2.00e-76 278.00
IUUC-Mtr-058051 Medicago truncatula 81.10 4.00e-163 566.00
IUUC-Mga-059229 Meleagris gallopavo 44.24 8.00e-82 296.00
IUUC-Mmr-060764 Microcebus murinus 44.82 2.00e-83 301.00
IUUC-Mdo-062088 Monodelphis domestica 43.60 1.00e-82 299.00
IUUC-Mmu-064304 Mus musculus 44.51 4.00e-83 300.00
IUUC-Mac-065520 Musa acuminata 75.54 7.00e-150 522.00
IUUC-Mpu-066340 Mustela putorius furo 44.82 2.00e-82 298.00
IUUC-Mlu-067111 Myotis lucifugus 44.51 2.00e-82 298.00
IUUC-Nfi-068478 Neosartorya fischeri 42.04 4.00e-74 270.00
IUUC-Ncr-068820 Neurospora crassa 44.82 2.00e-76 278.00
IUUC-Nle-069903 Nomascus leucogenys 44.82 8.00e-83 299.00
IUUC-Opr-070221 Ochotona princeps 43.60 2.00e-80 291.00
IUUC-Oan-073660 Ornithorhynchus anatinus 43.69 1.00e-70 258.00
IUUC-Ocu-074039 Oryctolagus cuniculus 44.82 1.00e-82 298.00
IUUC-Oba-075395 Oryza barthii 71.65 2.00e-137 480.00
IUUC-Obr-076334 Oryza brachyantha 74.39 5.00e-144 502.00
IUUC-Ogl-077751 Oryza glaberrima 78.35 7.00e-155 538.00
IUUC-Ogu-078207 Oryza glumaepatula 77.37 1.00e-151 528.00
IUUC-Oin-079878 Oryza indica 78.05 2.00e-153 534.00
IUUC-Olo-080677 Oryza longistaminata 67.02 4.00e-145 506.00
IUUC-Ome-081228 Oryza meridionalis 59.92 2.00e-78 284.00
IUUC-Oni-082411 Oryza nivara 68.90 2.00e-129 454.00
IUUC-Opu-083136 Oryza punctata 78.66 3.00e-155 540.00
IUUC-Oru-084916 Oryza rufipogon 75.96 2.00e-151 527.00
IUUC-Osa-085776 Oryza sativa 78.35 7.00e-155 538.00
IUUC-Olu-087602 Ostreococcus lucimarinus 58.72 6.00e-113 399.00
IUUC-Oga-088154 Otolemur garnettii 45.12 3.00e-83 301.00
IUUC-Oar-089915 Ovis aries 44.51 3.00e-82 297.00
IUUC-Ptr-091124 Pan troglodytes 36.50 3.00e-55 207.00
IUUC-Pan-092035 Papio anubis 45.12 2.00e-83 301.00
IUUC-Psi-094096 Pelodiscus sinensis 46.23 2.00e-49 187.00
IUUC-Pno-094988 Phaeosphaeria nodorum 43.73 4.00e-72 264.00
IUUC-Ppa-095949 Physcomitrella patens 69.82 2.00e-142 498.00
IUUC-Pab-097726 Pongo abelii 45.12 2.00e-83 301.00
IUUC-Pop-099617 Populus trichocarpa 79.88 9.00e-159 551.00
IUUC-Pca-101014 Procavia capensis 44.82 2.00e-83 301.00
IUUC-Ppe-101320 Prunus persica 82.93 2.00e-165 574.00
IUUC-Pva-102789 Pteropus vampyrus 42.38 1.00e-72 265.00
IUUC-Pte-104278 Pyrenophora teres 45.87 5.00e-80 290.00
IUUC-Pyt-104492 Pyrenophora triticirepentis 45.87 5.00e-80 290.00
IUUC-Rno-105867 Rattus norvegicus 42.07 1.00e-67 249.00
IUUC-Sce-106251 Saccharomyces cerevisiae 39.46 6.00e-70 256.00
IUUC-Sha-107039 Sarcophilus harrisii 43.60 8.00e-83 299.00
IUUC-Ssl-108478 Sclerotinia sclerotiorum 45.26 1.00e-79 288.00
IUUC-Smo-108728 Selaginella moellendorffii 71.25 9.00e-142 495.00
IUUC-Sit-110801 Setaria italica 77.13 1.00e-151 528.00
IUUC-Sly-111326 Solanum lycopersicum 81.10 5.00e-162 562.00
IUUC-Stu-112458 Solanum tuberosum 82.93 2.00e-164 571.00
IUUC-Sbi-114063 Sorghum bicolor 76.22 2.00e-150 523.00
IUUC-Ssc-116080 Sus scrofa 44.82 5.00e-83 300.00
IUUC-Tgu-116988 Taeniopygia guttata 44.65 6.00e-84 303.00
IUUC-Tca-121316 Theobroma cacao 82.32 1.00e-162 565.00
IUUC-Tre-122097 Trichoderma reesei 44.21 7.00e-76 276.00
IUUC-Tvi-122442 Trichoderma virens 43.90 1.00e-75 275.00
IUUC-Tae-125800 Triticum aestivum 77.13 7.00e-152 529.00
IUUC-Tur-126334 Triticum urartu 67.68 2.00e-126 444.00
IUUC-Tme-127038 Tuber melanosporum 45.29 5.00e-82 296.00
IUUC-Vda-129841 Verticillium dahliae 46.34 5.00e-78 283.00
IUUC-Vvi-131076 Vitis vinifera 80.18 1.00e-160 558.00
IUUC-Xtr-132395 Xenopus tropicalis 45.73 3.00e-86 311.00
IUUC-Zma-135667 Zea mays 75.91 1.00e-150 525.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved