• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • RAID2
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Bta-013519
UUCD1 version UUC-BoT-00969
Ensembl Protein ID ENSBTAP00000035184.4
UniProt Accession Q3ZCF3; SKP1_BOVIN
Genbank Protein ID ABM06147.1; AAI02436.1
Protein Name S-phase kinase-associated protein 1; Cyclin-A/CDK2-associated protein p19; S-phase kinase-associated protein 1A; p19A; p19skp1
Genbank Nucleotide ID BT029901; BC102435
Gene Name SKP1; SKP1A
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSBTAG00000025191.4 ENSBTAT00000035306.4 ENSBTAP00000035184.4
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 9.50e-32 109.1 113 160
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 1    ksLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    k+LLd+tcktVa+mikgktpeeiRktFni+nDft+eEea+vR+EnqW+
   Q: 113 KGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC 160
    89*********************************************9 PP
   

Organism Bos taurus
Functional Description
(View)

Functional Description



     Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2. SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) directs ubiquitination of TTI1 and TELO2. SCF(FBXO10) directs ubiquitination of BCL2.
Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2. SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) directs ubiquitination of TTI1 and TELO2. SCF(FBXO10) directs ubiquitination of BCL2.
Protein Sequence
(Fasta)
MPSIKLQSSD GEIFEVDVEI AKQSVTIKTM LEDLGMDDEG DDDPVPLPNV NAAILKKVIQ 60
WCTHHKDDPP PPEDDENKEK RTDDIPVWDQ EFLKVDQGTL FELILAANYL DIKGLLDVTC 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bta-013519|E3,SKP1|Bos taurus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GCGCTGTAGT GGCCTTGTTC TCCGCTTTTC AGTGTTGTTG TTTGACGACG TTGCCCTGCT 60
CACTTCAGCC TCCGGCCCGC CATCTCCTTG AGCCCTACCA CCGTAAGTGG ACGCCGACGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bta-013519|E3,SKP1|Bos taurus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1017--Isopeptide bond
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0832--Ubl conjugation
KW-0833--Ubl conjugation pathway

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0031467--C:Cul7-RING ubiquitin ligase complex
GO:0005829--C:cytosol
GO:0019005--C:SCF ubiquitin ligase complex
GO:0016567--P:protein ubiquitination
GO:0031146--P:SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

KEGG bta:615427
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001036 Aegilops tauschii 58.49 7.00e-48 182.00
IUUC-Aml-002023 Ailuropoda melanoleuca 100.00 2.00e-72 263.00
IUUC-Atr-002858 Amborella trichopoda 59.75 3.00e-36 144.00
IUUC-Apl-003393 Anas platyrhynchos 100.00 2.00e-72 263.00
IUUC-Aca-004709 Anolis carolinensis 100.00 2.00e-72 263.00
IUUC-Aly-006236 Arabidopsis lyrata 54.04 4.00e-43 166.00
IUUC-Ath-006881 Arabidopsis thaliana 55.29 7.00e-42 162.00
IUUC-Ago-007847 Ashbya gossypii 46.59 5.00e-37 147.00
IUUC-Acl-008178 Aspergillus clavatus 63.75 3.00e-52 197.00
IUUC-Afl-008452 Aspergillus flavus 62.96 7.00e-53 199.00
IUUC-Afu-008785 Aspergillus fumigatus 63.58 3.00e-53 200.00
IUUC-Ani-009312 Aspergillus nidulans 58.86 3.00e-48 184.00
IUUC-Aor-010012 Aspergillus oryzae 62.96 7.00e-53 199.00
IUUC-Ate-010375 Aspergillus terreus 63.98 5.00e-53 199.00
IUUC-Ame-011025 Astyanax mexicanus 98.77 1.00e-71 261.00
IUUC-Bgr-012280 Blumeria graminis 60.14 1.00e-38 152.00
IUUC-Bci-013888 Botrytis cinerea 65.29 5.00e-35 139.00
IUUC-Bdi-014547 Brachypodium distachyon 57.86 1.00e-37 149.00
IUUC-Bol-016431 Brassica oleracea 57.50 3.00e-40 157.00
IUUC-Bra-017558 Brassica rapa 56.17 4.00e-42 163.00
IUUC-Cel-018653 Caenorhabditis elegans 70.81 4.00e-54 203.00
IUUC-Cja-019785 Callithrix jacchus 96.88 6.00e-66 242.00
IUUC-Cfa-020931 Canis familiaris 99.39 2.00e-71 261.00
IUUC-Cpo-022487 Cavia porcellus 99.39 4.00e-70 256.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 59.24 2.00e-43 167.00
IUUC-Csa-023459 Chlorocebus sabaeus 99.39 6.00e-72 262.00
IUUC-Cho-024854 Choloepus hoffmanni 63.85 3.00e-30 123.00
IUUC-Cin-025538 Ciona intestinalis 89.57 1.00e-65 241.00
IUUC-Csv-025865 Ciona savignyi 89.57 5.00e-69 253.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 61.11 4.00e-43 167.00
IUUC-Cne-027058 Cryptococcus neoformans 55.49 1.00e-45 175.00
IUUC-Cme-027174 Cyanidioschyzon merolae 48.10 1.00e-37 148.00
IUUC-Dre-027756 Danio rerio 98.77 1.00e-71 261.00
IUUC-Dno-028924 Dasypus novemcinctus 100.00 2.00e-72 263.00
IUUC-Dor-030847 Dipodomys ordii 91.98 8.00e-67 245.00
IUUC-Dse-031209 Dothistroma septosporum 59.26 9.00e-48 182.00
IUUC-Dme-032028 Drosophila melanogaster 76.69 3.00e-62 230.00
IUUC-Ete-033117 Echinops telfairi 95.09 8.00e-68 248.00
IUUC-Eca-033320 Equus caballus 100.00 2.00e-72 263.00
IUUC-Fca-035423 Felis catus 100.00 2.00e-72 263.00
IUUC-Fal-036956 Ficedula albicollis 100.00 2.00e-72 263.00
IUUC-Fox-037761 Fusarium oxysporum 59.86 4.00e-43 167.00
IUUC-Fso-038451 Fusarium solani 59.46 2.00e-42 164.00
IUUC-Gmo-039178 Gadus morhua 99.39 6.00e-72 262.00
IUUC-Ggr-039831 Gaeumannomyces graminis 58.33 2.00e-41 160.00
IUUC-Gga-040238 Gallus gallus 100.00 2.00e-72 263.00
IUUC-Gac-041965 Gasterosteus aculeatus 99.39 6.00e-72 262.00
IUUC-Gma-042996 Glycine max 59.01 4.00e-38 150.00
IUUC-Ggo-045025 Gorilla gorilla 100.00 2.00e-72 263.00
IUUC-Hsa-046875 Homo sapiens 100.00 2.00e-72 263.00
IUUC-Hvu-047497 Hordeum vulgare 55.56 3.00e-40 157.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 97.55 2.00e-70 258.00
IUUC-Kpa-049138 Komagataella pastoris 46.15 1.00e-37 148.00
IUUC-Lch-050522 Latimeria chalumnae 98.72 2.00e-77 281.00
IUUC-Lpe-051398 Leersia perrieri 53.94 7.00e-42 163.00
IUUC-Loc-052596 Lepisosteus oculatus 99.39 6.00e-72 262.00
IUUC-Lma-053020 Leptosphaeria maculans 58.33 3.00e-40 157.00
IUUC-Laf-053847 Loxodonta africana 100.00 2.00e-72 263.00
IUUC-Mor-057176 Magnaporthe oryzae 57.64 5.00e-41 159.00
IUUC-Mpo-057471 Magnaporthe poae 58.33 2.00e-41 161.00
IUUC-Mtr-058258 Medicago truncatula 58.49 1.00e-41 161.00
IUUC-Mla-059153 Melampsora laricipopulina 60.87 7.00e-48 182.00
IUUC-Mga-059864 Meleagris gallopavo 100.00 2.00e-72 263.00
IUUC-Mvi-060342 Microbotryum violaceum 59.63 3.00e-48 184.00
IUUC-Mdo-062509 Monodelphis domestica 100.00 2.00e-72 263.00
IUUC-Mmu-063694 Mus musculus 99.39 6.00e-72 262.00
IUUC-Mac-064537 Musa acuminata 58.39 2.00e-38 150.00
IUUC-Mpu-065990 Mustela putorius furo 100.00 2.00e-72 263.00
IUUC-Mlu-068168 Myotis lucifugus 100.00 2.00e-72 263.00
IUUC-Nfi-068309 Neosartorya fischeri 63.58 3.00e-53 200.00
IUUC-Ncr-068658 Neurospora crassa 59.72 9.00e-43 166.00
IUUC-Nle-070101 Nomascus leucogenys 100.00 2.00e-72 263.00
IUUC-Opr-070881 Ochotona princeps 100.00 2.00e-72 263.00
IUUC-Ont-071529 Oreochromis niloticus 99.39 6.00e-72 262.00
IUUC-Oan-072985 Ornithorhynchus anatinus 99.06 3.00e-37 146.00
IUUC-Ocu-073780 Oryctolagus cuniculus 100.00 2.00e-72 263.00
IUUC-Oba-075368 Oryza barthii 52.35 1.00e-39 155.00
IUUC-Obr-076218 Oryza brachyantha 56.44 5.00e-39 154.00
IUUC-Ogl-077679 Oryza glaberrima 52.35 1.00e-39 155.00
IUUC-Ogu-078125 Oryza glumaepatula 54.71 2.00e-39 154.00
IUUC-Oin-079779 Oryza indica 52.35 2.00e-39 155.00
IUUC-Olo-080795 Oryza longistaminata 44.10 5.00e-26 110.00
IUUC-Ome-081330 Oryza meridionalis 55.03 1.00e-39 155.00
IUUC-Oni-082143 Oryza nivara 52.35 2.00e-39 155.00
IUUC-Opu-083354 Oryza punctata 53.85 2.00e-36 144.00
IUUC-Oru-085023 Oryza rufipogon 56.60 5.00e-37 146.00
IUUC-Osa-085416 Oryza sativa 52.35 2.00e-39 155.00
IUUC-Ola-087270 Oryzias latipes 99.39 6.00e-72 262.00
IUUC-Olu-087667 Ostreococcus lucimarinus 58.23 1.00e-46 178.00
IUUC-Oga-089073 Otolemur garnettii 100.00 2.00e-72 263.00
IUUC-Oar-089762 Ovis aries 81.52 5.00e-61 226.00
IUUC-Ptr-090872 Pan troglodytes 90.80 2.00e-67 247.00
IUUC-Pan-091780 Papio anubis 100.00 2.00e-72 263.00
IUUC-Psi-093135 Pelodiscus sinensis 100.00 2.00e-72 263.00
IUUC-Pno-094810 Phaeosphaeria nodorum 56.25 5.00e-38 150.00
IUUC-Ppa-095244 Physcomitrella patens 59.12 1.00e-42 165.00
IUUC-Pfo-097529 Poecilia formosa 99.39 6.00e-72 262.00
IUUC-Pab-098533 Pongo abelii 100.00 2.00e-72 263.00
IUUC-Pop-098957 Populus trichocarpa 59.24 7.00e-42 162.00
IUUC-Pca-100783 Procavia capensis 88.96 8.00e-60 222.00
IUUC-Ppe-101410 Prunus persica 56.79 9.00e-46 175.00
IUUC-Pva-102901 Pteropus vampyrus 100.00 2.00e-72 263.00
IUUC-Pgr-103499 Puccinia graminis 59.63 5.00e-48 182.00
IUUC-Ptt-103874 Puccinia triticina 62.96 2.00e-41 162.00
IUUC-Pte-104224 Pyrenophora teres 56.25 2.00e-33 134.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 56.55 2.00e-34 137.00
IUUC-Rno-105499 Rattus norvegicus 99.39 4.00e-72 263.00
IUUC-Sce-106387 Saccharomyces cerevisiae 42.93 1.00e-36 145.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 56.36 2.00e-47 181.00
IUUC-Spo-108033 Schizosaccharomyces pombe 56.36 6.00e-47 179.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 62.76 4.00e-42 163.00
IUUC-Smo-109307 Selaginella moellendorffii 56.55 3.00e-43 167.00
IUUC-Sit-110435 Setaria italica 55.09 8.00e-39 152.00
IUUC-Sly-111627 Solanum lycopersicum 57.86 2.00e-40 158.00
IUUC-Stu-112611 Solanum tuberosum 57.86 1.00e-40 158.00
IUUC-Sar-112973 Sorex araneus 90.80 3.00e-62 230.00
IUUC-Sbi-114394 Sorghum bicolor 56.10 2.00e-41 161.00
IUUC-Sre-115178 Sporisorium reilianum 61.49 3.00e-50 190.00
IUUC-Tgu-116474 Taeniopygia guttata 100.00 2.00e-72 263.00
IUUC-Tru-118429 Takifugu rubripes 98.77 6.00e-72 262.00
IUUC-Tsy-118896 Tarsius syrichta 100.00 2.00e-72 263.00
IUUC-Tni-119960 Tetraodon nigroviridis 98.77 6.00e-72 262.00
IUUC-Tca-121022 Theobroma cacao 59.63 3.00e-42 163.00
IUUC-Tre-122004 Trichoderma reesei 57.64 2.00e-35 141.00
IUUC-Tvi-122449 Trichoderma virens 57.64 6.00e-36 143.00
IUUC-Tae-125854 Triticum aestivum 58.49 7.00e-48 182.00
IUUC-Tur-126200 Triticum urartu 55.56 2.00e-45 174.00
IUUC-Tme-127078 Tuber melanosporum 57.93 3.00e-45 174.00
IUUC-Tbe-127720 Tupaia belangeri 100.00 2.00e-72 263.00
IUUC-Ttr-129035 Tursiops truncatus 100.00 2.00e-72 263.00
IUUC-Uma-129517 Ustilago maydis 59.01 3.00e-47 180.00
IUUC-Vda-129691 Verticillium dahliae 57.14 6.00e-42 163.00
IUUC-Vpa-130128 Vicugna pacos 100.00 3.00e-72 263.00
IUUC-Vvi-130876 Vitis vinifera 58.12 2.00e-45 174.00
IUUC-Xtr-132393 Xenopus tropicalis 100.00 2.00e-72 263.00
IUUC-Xma-133603 Xiphophorus maculatus 99.39 6.00e-72 262.00
IUUC-Yli-134499 Yarrowia lipolytica 55.15 4.00e-46 176.00
IUUC-Zma-134722 Zea mays 46.78 3.00e-35 142.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved