• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • Mentha
  • PTM
    • CPLM
    • PhosphositePlus
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Dre-028751
UUCD1 version UUC-DaR-01389
Ensembl Protein ID ENSDARP00000075198.4
UniProt Accession Q7ZVX6; UBA3_DANRE
Genbank Protein ID AAH45372.1
Protein Name NEDD8-activating enzyme E1 catalytic subunit; NEDD8-activating enzyme E1C; Ubiquitin-activating enzyme E1C; Ubiquitin-like modifier-activating enzyme 3
Genbank Nucleotide ID BC045372
Gene Name uba3; ube1c; zgc:55528
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSDARG00000057987.6 ENSDART00000080752.6 ENSDARP00000075198.4
ENSDARG00000057987.6 ENSDART00000153801.1 ENSDARP00000127871.1
Status Unreviewed
Classification
Family E-Value Score Start End
E1 2.40e-95 321.1 65 253
Active Site
Position(s) Description Evidence
236 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU10132}
Domain Profile

   E1

   S: 15   klksakvllvGagglGcEllKnLvlaGvgsitvvDmdtvevsnlnrqFLfraedvgksKAevaaealkelnpdvnveaheesiteleee 103
    l+++k+l++GagglGcEllK L+l+G+++i+vvDmdt++vsnlnrqFLfr++dvg++KAevaa+++++++p ++v++h ++i++l+e+
   Q: 65 LLDTCKILVIGAGGLGCELLKDLALSGFRHIHVVDMDTIDVSNLNRQFLFRPKDVGRPKAEVAADFVNDRVPGCSVVPHFKKIQDLDET 153
    589************************************************************************************** PP
   S: 104 ivFfkkfdvVvlaldnrearrkvnrlclna............rvpliesgtlGllGqvrviikgltecyscsd..dppqktiPfctlke 178
    F+++f++Vv++ld++ arr++n ++l++ +pli++gt+G++G++rvi++g+t+c++c+ +ppq ++P+ct+++
   Q: 154 --FYRQFHIVVCGLDSVIARRWMNGMLLSLliyedgvldpssIIPLIDGGTEGFKGNARVILPGMTACIDCTLelYPPQINFPMCTIAS 240
    ..*************************************************************************************** PP
   S: 179 tpnaaehtiewav 191
    +p+ +eh++e+++
   Q: 241 MPRLPEHCVEYVR 253
    ***********93 PP
   

Organism Danio rerio
Functional Description
(View)

Functional Description



     Catalytic subunit of the dimeric uba3-nae1 E1 enzyme. E1 activates nedd8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a nedd8-uba3 thioester and free AMP. E1 finally transfers nedd8 to the catalytic cysteine of ube2m (By similarity).
Catalytic subunit of the dimeric uba3-nae1 E1 enzyme. E1 activates nedd8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a nedd8-uba3 thioester and free AMP. E1 finally transfers nedd8 to the catalytic cysteine of ube2m (By similarity).
Protein Sequence
(Fasta)
MAEGEEPEKK RRRIEELNEK MVVDGGSGDR SEWQGRWDHV RKFLERTGPF THPDFEASTE 60
SLQFLLDTCK ILVIGAGGLG CELLKDLALS GFRHIHVVDM DTIDVSNLNR QFLFRPKDVG 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Dre-028751|E1,E1_ThiF|Danio rerio
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GTGACTTTTA TTATGAAAAG TCGTAGTGCG TCAGCTGGAT AGCAGTTTTC CGTGTCATAA 60
GATTGCGCAT TTCAATTTGA GCGTTTATGA CAATATGGCG GAAGGAGAGG AACCGTAAGT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Dre-028751|E1,E1_ThiF|Danio rerio
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0436--Ligase
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR014929--E2_binding
IPR016040--NAD(P)-bd_dom
IPR000594--ThiF_NAD_FAD-bd
IPR030468--Uba3
IPR033127--UBQ-activ_enz_E1_Cys_AS

PROSITE

PS00865--UBIQUITIN_ACTIVAT_2

Pfam

PF08825--E2_bind
PF00899--ThiF

SMART

SM01181--E2_bind

Gene Ontology

GO:0016881--F:acid-amino acid ligase activity
GO:0005524--F:ATP binding
GO:0019781--F:NEDD8 activating enzyme activity
GO:0045116--P:protein neddylation

KEGG dre:406776
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001124 Aegilops tauschii 46.48 1.00e-78 286.00
IUUC-Aml-001578 Ailuropoda melanoleuca 86.40 0.00e+00 844.00
IUUC-Atr-002591 Amborella trichopoda 48.64 4.00e-89 322.00
IUUC-Apl-003671 Anas platyrhynchos 84.23 0.00e+00 819.00
IUUC-Aca-004749 Anolis carolinensis 84.31 0.00e+00 785.00
IUUC-Aly-005747 Arabidopsis lyrata 47.39 3.00e-95 342.00
IUUC-Ath-006623 Arabidopsis thaliana 47.64 5.00e-95 341.00
IUUC-Ago-007934 Ashbya gossypii 44.76 4.00e-71 261.00
IUUC-Acl-008047 Aspergillus clavatus 50.35 9.00e-121 426.00
IUUC-Afl-008615 Aspergillus flavus 44.00 4.00e-77 281.00
IUUC-Afu-008996 Aspergillus fumigatus 50.94 2.00e-113 402.00
IUUC-Ani-009281 Aspergillus nidulans 43.53 2.00e-83 303.00
IUUC-Ang-009539 Aspergillus niger 50.59 2.00e-110 392.00
IUUC-Aor-010151 Aspergillus oryzae 48.99 9.00e-107 380.00
IUUC-Ate-010502 Aspergillus terreus 52.11 2.00e-113 402.00
IUUC-Ame-011837 Astyanax mexicanus 90.04 0.00e+00 813.00
IUUC-Bgr-012068 Blumeria graminis 48.31 2.00e-113 402.00
IUUC-Bta-013003 Bos taurus 86.20 0.00e+00 826.00
IUUC-Bci-013983 Botrytis cinerea 53.38 2.00e-123 436.00
IUUC-Bdi-014429 Brachypodium distachyon 46.91 2.00e-84 306.00
IUUC-Bol-015813 Brassica oleracea 48.14 4.00e-88 318.00
IUUC-Bra-018023 Brassica rapa 47.15 2.00e-85 309.00
IUUC-Cel-018684 Caenorhabditis elegans 51.75 1.00e-127 449.00
IUUC-Cja-019200 Callithrix jacchus 86.71 0.00e+00 823.00
IUUC-Cfa-021038 Canis familiaris 86.65 0.00e+00 829.00
IUUC-Cre-022778 Chlamydomonas reinhardtii 48.78 9.00e-107 380.00
IUUC-Csa-024079 Chlorocebus sabaeus 86.65 0.00e+00 830.00
IUUC-Cho-025052 Choloepus hoffmanni 78.28 0.00e+00 734.00
IUUC-Cin-025113 Ciona intestinalis 68.36 2.00e-180 625.00
IUUC-Csv-026231 Ciona savignyi 65.66 4.00e-180 624.00
IUUC-Cgl-026535 Colletotrichum gloeosporioides 52.09 2.00e-124 439.00
IUUC-Cne-026850 Cryptococcus neoformans 47.65 3.00e-106 378.00
IUUC-Cme-027275 Cyanidioschyzon merolae 36.41 1.00e-69 257.00
IUUC-Dno-029571 Dasypus novemcinctus 86.20 0.00e+00 828.00
IUUC-Dor-030395 Dipodomys ordii 85.07 0.00e+00 798.00
IUUC-Dse-031329 Dothistroma septosporum 46.67 3.00e-103 368.00
IUUC-Dme-031776 Drosophila melanogaster 64.04 8.00e-162 563.00
IUUC-Ete-032894 Echinops telfairi 71.18 1.00e-65 243.00
IUUC-Eca-034389 Equus caballus 83.77 0.00e+00 830.00
IUUC-Eeu-035152 Erinaceus europaeus 76.87 0.00e+00 638.00
IUUC-Fca-036032 Felis catus 85.75 0.00e+00 833.00
IUUC-Fal-037506 Ficedula albicollis 83.56 0.00e+00 812.00
IUUC-Fox-037871 Fusarium oxysporum 53.60 1.00e-109 389.00
IUUC-Fso-038350 Fusarium solani 52.10 4.00e-121 428.00
IUUC-Gmo-039647 Gadus morhua 85.50 0.00e+00 814.00
IUUC-Ggr-039859 Gaeumannomyces graminis 52.68 1.00e-118 419.00
IUUC-Gga-040843 Gallus gallus 81.17 0.00e+00 780.00
IUUC-Gac-042601 Gasterosteus aculeatus 86.80 0.00e+00 831.00
IUUC-Gma-042744 Glycine max 49.15 2.00e-88 319.00
IUUC-Ggo-044788 Gorilla gorilla 86.23 0.00e+00 823.00
IUUC-Hsa-045849 Homo sapiens 86.65 0.00e+00 830.00
IUUC-Hvu-047819 Hordeum vulgare 50.45 7.00e-79 287.00
IUUC-Itr-047863 Ictidomys tridecemlineatus 86.00 0.00e+00 830.00
IUUC-Kpa-049393 Komagataella pastoris 52.89 5.00e-98 350.00
IUUC-Lch-049471 Latimeria chalumnae 87.00 0.00e+00 805.00
IUUC-Lpe-051297 Leersia perrieri 46.39 3.00e-95 342.00
IUUC-Loc-052910 Lepisosteus oculatus 88.06 0.00e+00 804.00
IUUC-Lma-053181 Leptosphaeria maculans 50.11 3.00e-122 431.00
IUUC-Laf-054314 Loxodonta africana 85.39 0.00e+00 818.00
IUUC-Mcc-054870 Macaca mulatta 86.65 0.00e+00 829.00
IUUC-Meu-056574 Macropus eugenii 72.79 3.00e-121 428.00
IUUC-Mor-056919 Magnaporthe oryzae 51.28 1.00e-117 416.00
IUUC-Mpo-057614 Magnaporthe poae 53.49 1.00e-114 406.00
IUUC-Mtr-058110 Medicago truncatula 48.59 8.00e-87 314.00
IUUC-Mla-058949 Melampsora laricipopulina 51.59 1.00e-112 400.00
IUUC-Mga-059455 Meleagris gallopavo 84.23 0.00e+00 817.00
IUUC-Mvi-060270 Microbotryum violaceum 51.25 4.00e-115 408.00
IUUC-Mmr-061155 Microcebus murinus 81.62 0.00e+00 793.00
IUUC-Mdo-062037 Monodelphis domestica 86.65 0.00e+00 798.00
IUUC-Mmu-063670 Mus musculus 87.05 0.00e+00 830.00
IUUC-Mac-064711 Musa acuminata 47.07 3.00e-86 312.00
IUUC-Mpu-066734 Mustela putorius furo 86.07 0.00e+00 825.00
IUUC-Mlu-067068 Myotis lucifugus 87.59 0.00e+00 806.00
IUUC-Nfi-068349 Neosartorya fischeri 50.00 8.00e-113 400.00
IUUC-Ncr-068626 Neurospora crassa 52.76 8.00e-107 380.00
IUUC-Nle-069366 Nomascus leucogenys 79.42 0.00e+00 743.00
IUUC-Opr-070993 Ochotona princeps 85.38 2.00e-65 243.00
IUUC-Ont-071265 Oreochromis niloticus 86.36 0.00e+00 828.00
IUUC-Oan-073511 Ornithorhynchus anatinus 86.43 0.00e+00 824.00
IUUC-Ocu-073773 Oryctolagus cuniculus 86.88 0.00e+00 830.00
IUUC-Oba-075726 Oryza barthii 43.36 7.00e-84 304.00
IUUC-Obr-076286 Oryza brachyantha 45.67 2.00e-91 329.00
IUUC-Ogu-078473 Oryza glumaepatula 43.36 5.00e-84 305.00
IUUC-Oin-079393 Oryza indica 47.76 8.00e-97 347.00
IUUC-Olo-080446 Oryza longistaminata 44.95 1.00e-87 317.00
IUUC-Ome-081737 Oryza meridionalis 45.52 2.00e-87 316.00
IUUC-Oni-082853 Oryza nivara 43.36 7.00e-84 304.00
IUUC-Opu-083590 Oryza punctata 46.88 5.00e-96 344.00
IUUC-Oru-084184 Oryza rufipogon 43.36 7.00e-84 304.00
IUUC-Osa-085402 Oryza sativa 47.76 8.00e-97 347.00
IUUC-Ola-086615 Oryzias latipes 81.60 0.00e+00 766.00
IUUC-Olu-087738 Ostreococcus lucimarinus 47.64 2.00e-90 326.00
IUUC-Oga-088101 Otolemur garnettii 86.43 0.00e+00 826.00
IUUC-Oar-090293 Ovis aries 85.04 0.00e+00 819.00
IUUC-Ptr-090503 Pan troglodytes 86.65 0.00e+00 830.00
IUUC-Pan-092477 Papio anubis 84.49 0.00e+00 801.00
IUUC-Psi-093442 Pelodiscus sinensis 85.68 0.00e+00 815.00
IUUC-Pma-094247 Petromyzon marinus 80.36 0.00e+00 753.00
IUUC-Pno-094780 Phaeosphaeria nodorum 51.65 4.00e-116 411.00
IUUC-Ppa-095338 Physcomitrella patens 49.52 1.00e-117 416.00
IUUC-Pfo-096846 Poecilia formosa 84.23 0.00e+00 808.00
IUUC-Pab-098060 Pongo abelii 86.20 0.00e+00 792.00
IUUC-Pop-099470 Populus trichocarpa 47.44 3.00e-93 335.00
IUUC-Pca-100500 Procavia capensis 70.35 0.00e+00 666.00
IUUC-Ppe-102008 Prunus persica 48.44 4.00e-85 308.00
IUUC-Pva-103095 Pteropus vampyrus 86.19 2.00e-114 405.00
IUUC-Pgr-103666 Puccinia graminis 50.48 4.00e-111 395.00
IUUC-Ptt-103901 Puccinia triticina 50.80 3.00e-115 409.00
IUUC-Pte-104198 Pyrenophora teres 49.66 8.00e-121 427.00
IUUC-Pyt-104792 Pyrenophora triticirepentis 48.05 9.00e-117 413.00
IUUC-Rno-105446 Rattus norvegicus 87.05 0.00e+00 830.00
IUUC-Sce-106355 Saccharomyces cerevisiae 42.02 1.00e-69 256.00
IUUC-Sha-106664 Sarcophilus harrisii 87.35 0.00e+00 805.00
IUUC-Sja-107982 Schizosaccharomyces japonicus 43.36 2.00e-95 343.00
IUUC-Spo-108345 Schizosaccharomyces pombe 41.32 4.00e-97 348.00
IUUC-Ssl-108540 Sclerotinia sclerotiorum 50.00 5.00e-107 381.00
IUUC-Smo-109098 Selaginella moellendorffii 48.34 9.00e-113 400.00
IUUC-Sit-109724 Setaria italica 47.28 4.00e-87 315.00
IUUC-Sly-110916 Solanum lycopersicum 48.33 4.00e-94 338.00
IUUC-Stu-112236 Solanum tuberosum 48.07 7.00e-94 337.00
IUUC-Sar-113044 Sorex araneus 86.82 0.00e+00 751.00
IUUC-Sbi-114276 Sorghum bicolor 47.39 5.00e-87 315.00
IUUC-Sre-114963 Sporisorium reilianum 52.45 2.00e-116 412.00
IUUC-Ssc-116301 Sus scrofa 85.46 0.00e+00 820.00
IUUC-Tgu-117265 Taeniopygia guttata 83.33 0.00e+00 808.00
IUUC-Tru-117526 Takifugu rubripes 85.34 0.00e+00 797.00
IUUC-Tsy-119483 Tarsius syrichta 87.20 0.00e+00 778.00
IUUC-Tni-120363 Tetraodon nigroviridis 85.53 0.00e+00 794.00
IUUC-Tca-121731 Theobroma cacao 48.35 8.00e-87 314.00
IUUC-Tre-122221 Trichoderma reesei 53.07 9.00e-111 393.00
IUUC-Tvi-122352 Trichoderma virens 52.21 9.00e-124 436.00
IUUC-Tae-123864 Triticum aestivum 46.63 5.00e-87 315.00
IUUC-Tur-126070 Triticum urartu 43.53 2.00e-68 253.00
IUUC-Tme-127199 Tuber melanosporum 51.04 1.00e-107 383.00
IUUC-Tbe-128076 Tupaia belangeri 86.20 0.00e+00 827.00
IUUC-Ttr-128695 Tursiops truncatus 71.49 0.00e+00 663.00
IUUC-Uma-129638 Ustilago maydis 51.75 5.00e-118 417.00
IUUC-Vda-129963 Verticillium dahliae 53.61 2.00e-114 405.00
IUUC-Vpa-130637 Vicugna pacos 78.96 0.00e+00 736.00
IUUC-Vvi-131613 Vitis vinifera 47.88 4.00e-84 305.00
IUUC-Xtr-132924 Xenopus tropicalis 83.67 0.00e+00 769.00
IUUC-Xma-133356 Xiphophorus maculatus 85.96 0.00e+00 810.00
IUUC-Yli-134365 Yarrowia lipolytica 50.38 9.00e-106 377.00
IUUC-Zma-135941 Zea mays 43.24 8.00e-82 297.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved