• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • PTM
    • CPLM
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Itr-048429
UUCD1 version UUC-SpT-00654
Ensembl Protein ID ENSSTOP00000009175.2
UniProt Accession Q2EF73; UBC9_ICTTR
Genbank Protein ID ABD39323.1
Protein Name SUMO-conjugating enzyme UBC9; RING-type E3 SUMO transferase UBC9; SUMO-protein ligase; Ubiquitin carrier protein 9; Ubiquitin carrier protein I; Ubiquitin-conjugating enzyme E2 I; Ubiquitin-protein ligase I
Genbank Nucleotide ID DQ385871
Gene Name UBE2I; UBC9
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSSTOG00000010233.2 ENSSTOT00000010227.2 ENSSTOP00000009175.2
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 6.90e-50 168.4 8 149
Active Site
Position(s) Description Evidence
93 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 1    Rlkkelkelekdppegisakpvdesd....ltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsi 85
    Rl++e k+++kd+p g++a p+++ d l++we++i G+++tp+egg+Fkl++ f++dYP++PPk+kf+ ++fhPnvy++G+vClsi
   Q: 8 RLAQERKAWRKDHPFGFVAVPTKNPDgtmnLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSI 96
    99*****************99998877777*********************************************************** PP
   S: 86 lkeeekWspalsvesvllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    l+e+++W+pa++++++ll+iq+ll+epn+++p+++ea++++++nr ey+k+vr
   Q: 97 LEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR 149
    ***************************************************98 PP
   

Organism Ictidomys tridecemlineatus
Functional Description
(View)

Functional Description



     Accepts the ubiquitin-like proteins SUMO1, SUMO2 and SUMO3 from the UBLE1A-UBLE1B E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as RANBP2, CBX4 and ZNF451. Can catalyze the formation of poly-SUMO chains. Essential for nuclear architecture and chromosome segregation (By similarity). Necessary for sumoylation of FOXL2 and KAT5. Sumoylates p53/TP53 at 'Lys-386'.
Accepts the ubiquitin-like proteins SUMO1, SUMO2 and SUMO3 from the UBLE1A-UBLE1B E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as RANBP2, CBX4 and ZNF451. Can catalyze the formation of poly-SUMO chains. Essential for nuclear architecture and chromosome segregation (By similarity). Necessary for sumoylation of FOXL2 and KAT5. Sumoylates p53/TP53 at 'Lys-386'.
Protein Sequence
(Fasta)
MSGIALSRLA QERKAWRKDH PFGFVAVPTK NPDGTMNLMN WECAIPGKKG TPWEGGLFKL 60
RMLFKDDYPS SPPKCKFEPP LFHPNVYPSG TVCLSILEED KDWRPAITIK QILLGIQELL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Itr-048429|E2,E2/UBC|Ictidomys tridecemlineatus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TCTATTGCAG GGACTTTGAA CATGTCGGGG ATCGCCCTCA GCAGACTCGC CCAGGAGAGA 60
AAAGCTTGGA GGAAGGACCA TCCTTTTGTA AGGACTCTGT TTCTCTGCTG CCCAGGGCAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Itr-048429|E2,E2/UBC|Ictidomys tridecemlineatus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0007--Acetylation
KW-0067--ATP-binding
KW-0131--Cell cycle
KW-0132--Cell division
KW-0159--Chromosome partition
KW-0181--Complete proteome
KW-1017--Isopeptide bond
KW-0498--Mitosis
KW-0547--Nucleotide-binding
KW-0539--Nucleus
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0808--Transferase
KW-0832--Ubl conjugation
KW-0833--Ubl conjugation pathway

Interpro

IPR027230--Ubc9
IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005829--C:cytosol
GO:0016605--C:PML body
GO:1990234--C:transferase complex
GO:0005524--F:ATP binding
GO:0003723--F:RNA binding
GO:0061656--F:SUMO conjugating enzyme activity
GO:0051301--P:cell division
GO:0007059--P:chromosome segregation
GO:0007067--P:mitotic nuclear division
GO:0000122--P:negative regulation of transcription from RNA polymerase II promoter
GO:0043123--P:positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:1903755--P:positive regulation of SUMO transferase activity

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000510 Aegilops tauschii 64.76 9.00e-39 152.00
IUUC-Aml-002383 Ailuropoda melanoleuca 100.00 1.00e-92 331.00
IUUC-Atr-002982 Amborella trichopoda 64.10 1.00e-49 187.00
IUUC-Apl-003840 Anas platyrhynchos 100.00 1.00e-92 331.00
IUUC-Aca-004772 Anolis carolinensis 100.00 1.00e-92 331.00
IUUC-Aly-005652 Arabidopsis lyrata 66.23 4.00e-60 223.00
IUUC-Ath-007084 Arabidopsis thaliana 66.23 4.00e-60 223.00
IUUC-Ago-007998 Ashbya gossypii 57.69 2.00e-53 200.00
IUUC-Acl-008040 Aspergillus clavatus 63.16 4.00e-50 189.00
IUUC-Afl-008563 Aspergillus flavus 62.50 8.00e-50 188.00
IUUC-Afu-008873 Aspergillus fumigatus 65.25 2.00e-47 181.00
IUUC-Ani-009222 Aspergillus nidulans 64.47 7.00e-51 192.00
IUUC-Ang-009740 Aspergillus niger 68.61 2.00e-48 184.00
IUUC-Aor-010170 Aspergillus oryzae 63.16 4.00e-50 189.00
IUUC-Ate-010410 Aspergillus terreus 63.82 2.00e-50 190.00
IUUC-Ame-011711 Astyanax mexicanus 94.30 6.00e-89 318.00
IUUC-Bgr-012012 Blumeria graminis 55.92 1.00e-48 184.00
IUUC-Bta-013269 Bos taurus 100.00 1.00e-92 331.00
IUUC-Bci-013748 Botrytis cinerea 61.59 3.00e-47 180.00
IUUC-Bdi-014883 Brachypodium distachyon 64.94 1.00e-58 218.00
IUUC-Bol-016125 Brassica oleracea 66.03 1.00e-51 194.00
IUUC-Bra-017235 Brassica rapa 66.03 1.00e-51 194.00
IUUC-Cel-018448 Caenorhabditis elegans 76.92 6.00e-75 272.00
IUUC-Cja-019349 Callithrix jacchus 100.00 1.00e-92 331.00
IUUC-Cfa-021008 Canis familiaris 99.11 5.00e-65 239.00
IUUC-Cpo-021324 Cavia porcellus 100.00 1.00e-92 331.00
IUUC-Cre-022836 Chlamydomonas reinhardtii 61.15 5.00e-57 213.00
IUUC-Csa-024207 Chlorocebus sabaeus 100.00 1.00e-92 331.00
IUUC-Cin-025734 Ciona intestinalis 82.69 5.00e-79 285.00
IUUC-Csv-026049 Ciona savignyi 81.41 1.00e-77 281.00
IUUC-Cgl-026699 Colletotrichum gloeosporioides 63.70 2.00e-54 204.00
IUUC-Cne-027034 Cryptococcus neoformans 61.78 4.00e-60 223.00
IUUC-Cme-027203 Cyanidioschyzon merolae 59.35 3.00e-49 187.00
IUUC-Dre-027701 Danio rerio 99.36 8.00e-92 328.00
IUUC-Dno-030037 Dasypus novemcinctus 100.00 1.00e-92 331.00
IUUC-Dor-030622 Dipodomys ordii 98.54 2.00e-78 283.00
IUUC-Dse-031366 Dothistroma septosporum 62.91 6.00e-56 209.00
IUUC-Dme-031818 Drosophila melanogaster 85.44 4.00e-82 296.00
IUUC-Ete-032517 Echinops telfairi 100.00 1.00e-79 287.00
IUUC-Eca-033789 Equus caballus 100.00 1.00e-92 331.00
IUUC-Fca-035851 Felis catus 100.00 1.00e-92 331.00
IUUC-Fal-037177 Ficedula albicollis 100.00 1.00e-92 331.00
IUUC-Fox-037789 Fusarium oxysporum 62.50 2.00e-57 214.00
IUUC-Fso-038166 Fusarium solani 64.63 5.00e-57 212.00
IUUC-Gmo-039482 Gadus morhua 99.37 2.00e-92 330.00
IUUC-Ggr-039892 Gaeumannomyces graminis 65.93 4.00e-53 200.00
IUUC-Gga-041199 Gallus gallus 100.00 1.00e-92 331.00
IUUC-Gac-042250 Gasterosteus aculeatus 99.37 2.00e-92 330.00
IUUC-Gma-043827 Glycine max 66.24 2.00e-61 227.00
IUUC-Ggo-045530 Gorilla gorilla 100.00 1.00e-92 331.00
IUUC-Hsa-046248 Homo sapiens 100.00 1.00e-92 331.00
IUUC-Hvu-047363 Hordeum vulgare 62.34 4.00e-57 213.00
IUUC-Kpa-049362 Komagataella pastoris 58.33 4.00e-53 199.00
IUUC-Lch-050644 Latimeria chalumnae 97.47 4.00e-91 326.00
IUUC-Lpe-051643 Leersia perrieri 65.58 9.00e-60 222.00
IUUC-Loc-052357 Lepisosteus oculatus 99.37 3.00e-92 329.00
IUUC-Lma-053142 Leptosphaeria maculans 61.59 6.00e-57 212.00
IUUC-Laf-053577 Loxodonta africana 100.00 1.00e-92 331.00
IUUC-Mcc-054925 Macaca mulatta 100.00 1.00e-92 331.00
IUUC-Meu-056094 Macropus eugenii 81.75 2.00e-60 224.00
IUUC-Mor-057141 Magnaporthe oryzae 61.22 5.00e-56 209.00
IUUC-Mpo-057613 Magnaporthe poae 65.19 3.00e-52 196.00
IUUC-Mtr-058465 Medicago truncatula 67.10 1.00e-62 231.00
IUUC-Mla-059115 Melampsora laricipopulina 65.19 1.00e-61 228.00
IUUC-Mga-059384 Meleagris gallopavo 100.00 1.00e-92 331.00
IUUC-Mvi-060328 Microbotryum violaceum 62.18 5.00e-48 182.00
IUUC-Mmr-061541 Microcebus murinus 100.00 1.00e-92 331.00
IUUC-Mdo-062540 Monodelphis domestica 100.00 1.00e-92 331.00
IUUC-Mmu-063818 Mus musculus 100.00 1.00e-92 331.00
IUUC-Mac-065019 Musa acuminata 65.38 2.00e-60 223.00
IUUC-Mpu-065734 Mustela putorius furo 100.00 1.00e-92 331.00
IUUC-Mlu-067619 Myotis lucifugus 100.00 1.00e-92 331.00
IUUC-Nfi-068567 Neosartorya fischeri 63.82 8.00e-51 192.00
IUUC-Ncr-068897 Neurospora crassa 62.99 5.00e-57 213.00
IUUC-Nle-069541 Nomascus leucogenys 100.00 6.00e-92 328.00
IUUC-Ont-071585 Oreochromis niloticus 99.37 2.00e-92 330.00
IUUC-Oan-073178 Ornithorhynchus anatinus 100.00 2.00e-42 162.00
IUUC-Ocu-074588 Oryctolagus cuniculus 92.41 2.00e-82 297.00
IUUC-Oba-075371 Oryza barthii 64.74 4.00e-59 219.00
IUUC-Obr-076199 Oryza brachyantha 64.74 3.00e-59 220.00
IUUC-Ogl-077506 Oryza glaberrima 64.74 4.00e-59 219.00
IUUC-Ogu-078474 Oryza glumaepatula 64.74 4.00e-59 219.00
IUUC-Oin-080036 Oryza indica 64.74 4.00e-59 219.00
IUUC-Olo-080940 Oryza longistaminata 58.44 3.00e-50 190.00
IUUC-Ome-081909 Oryza meridionalis 64.29 3.00e-58 217.00
IUUC-Oni-082340 Oryza nivara 64.74 4.00e-59 219.00
IUUC-Opu-083206 Oryza punctata 64.74 3.00e-59 219.00
IUUC-Oru-084239 Oryza rufipogon 64.74 4.00e-59 219.00
IUUC-Osa-086213 Oryza sativa 64.74 4.00e-59 219.00
IUUC-Ola-086314 Oryzias latipes 95.57 1.00e-89 321.00
IUUC-Olu-087715 Ostreococcus lucimarinus 54.09 4.00e-48 183.00
IUUC-Oga-088729 Otolemur garnettii 100.00 8.00e-80 288.00
IUUC-Oar-090221 Ovis aries 100.00 2.00e-92 330.00
IUUC-Ptr-090528 Pan troglodytes 100.00 1.00e-92 331.00
IUUC-Pan-092834 Papio anubis 100.00 1.00e-92 331.00
IUUC-Psi-093001 Pelodiscus sinensis 100.00 1.00e-92 331.00
IUUC-Pma-094539 Petromyzon marinus 96.84 1.00e-90 324.00
IUUC-Pno-094954 Phaeosphaeria nodorum 60.65 1.00e-55 207.00
IUUC-Ppa-095314 Physcomitrella patens 64.74 2.00e-59 220.00
IUUC-Pfo-097457 Poecilia formosa 98.73 5.00e-92 328.00
IUUC-Pab-098205 Pongo abelii 100.00 1.00e-92 331.00
IUUC-Pop-099063 Populus trichocarpa 66.23 5.00e-60 222.00
IUUC-Pca-100603 Procavia capensis 100.00 2.00e-79 287.00
IUUC-Ppe-101501 Prunus persica 66.67 3.00e-51 193.00
IUUC-Pva-103251 Pteropus vampyrus 78.10 5.00e-56 209.00
IUUC-Pte-104067 Pyrenophora teres 58.28 5.00e-55 206.00
IUUC-Pyt-104436 Pyrenophora triticirepentis 58.28 4.00e-55 206.00
IUUC-Rno-105794 Rattus norvegicus 100.00 1.00e-92 331.00
IUUC-Sce-106308 Saccharomyces cerevisiae 56.41 4.00e-53 199.00
IUUC-Sha-106997 Sarcophilus harrisii 90.62 1.00e-82 298.00
IUUC-Sja-108000 Schizosaccharomyces japonicus 67.31 5.00e-56 209.00
IUUC-Spo-108311 Schizosaccharomyces pombe 66.24 3.00e-55 206.00
IUUC-Smo-108685 Selaginella moellendorffii 66.67 5.00e-52 196.00
IUUC-Sit-109792 Setaria italica 65.58 2.00e-59 221.00
IUUC-Sly-110998 Solanum lycopersicum 63.46 3.00e-59 220.00
IUUC-Stu-111975 Solanum tuberosum 66.23 3.00e-54 203.00
IUUC-Sbi-114672 Sorghum bicolor 65.58 2.00e-59 221.00
IUUC-Sre-114957 Sporisorium reilianum 69.23 1.00e-65 241.00
IUUC-Ssc-116173 Sus scrofa 100.00 1.00e-92 331.00
IUUC-Tgu-116668 Taeniopygia guttata 100.00 1.00e-92 331.00
IUUC-Tru-118365 Takifugu rubripes 97.47 8.00e-91 325.00
IUUC-Tni-120455 Tetraodon nigroviridis 95.57 2.00e-89 320.00
IUUC-Tca-120956 Theobroma cacao 65.38 6.00e-59 219.00
IUUC-Tre-121927 Trichoderma reesei 63.95 8.00e-58 215.00
IUUC-Tvi-122363 Trichoderma virens 63.95 2.00e-57 213.00
IUUC-Tae-125311 Triticum aestivum 65.58 2.00e-59 220.00
IUUC-Tur-126625 Triticum urartu 64.94 6.00e-59 219.00
IUUC-Tme-126981 Tuber melanosporum 55.10 2.00e-37 147.00
IUUC-Ttr-128280 Tursiops truncatus 100.00 1.00e-48 183.00
IUUC-Uma-129582 Ustilago maydis 69.23 2.00e-65 240.00
IUUC-Vda-129845 Verticillium dahliae 65.99 4.00e-58 216.00
IUUC-Vpa-130242 Vicugna pacos 100.00 1.00e-79 287.00
IUUC-Vvi-130948 Vitis vinifera 64.74 3.00e-59 219.00
IUUC-Xtr-132540 Xenopus tropicalis 100.00 2.00e-92 330.00
IUUC-Xma-133010 Xiphophorus maculatus 98.73 5.00e-92 328.00
IUUC-Yli-134673 Yarrowia lipolytica 54.36 7.00e-51 192.00
IUUC-Zma-135055 Zea mays 65.58 1.00e-59 221.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved