• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • PTM
    • dbPAF
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Kpa-049138
Ensembl Protein ID CAY71198
UniProt Accession C4R364; C4R364_KOMPG
Genbank Protein ID CAY71198.1
Protein Name Uncharacterized protein
Genbank Nucleotide ID FN392321
Gene Name PAS_chr3_1258
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
PAS_chr3_1258 CAY71198 CAY71198
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 2.30e-26 89.8 139 185
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 2    sLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    +LL +ck Va+mi+gk+peeiRktFni nDf+peEea++R+En+WA
   Q: 139 PLLYSGCKMVAEMIRGKSPEEIRKTFNIVNDFSPEEEAAIRRENEWA 185
    79999*****************************************9 PP
   

Organism Komagataella pastoris
Protein Sequence
(Fasta)
MSKEKKIVIV SSDNEKFTVD RKVAEKSILI KNMLEDLLSN EDHNGDNDDD NELLRDAAAV 60
DNNDLDVIEI PTPNVRSTVL KLIIEWCEHY KDISFPDENQ DEDSKKTPPI DEWDKNFLNV 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Kpa-049138|E3,SKP1|Komagataella pastoris
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCCAAAG AAAAGAAAAT TGTGATTGTT TCATCTGATA ACGAAAAGTT TACGGTGGAT 60
CGTAAGGTTG CCGAAAAGTC TATTTTGATC AAGAATATGT TGGAGGATCT TCTCTCCAAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Kpa-049138|E3,SKP1|Komagataella pastoris
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0031518--C:CBF3 complex
GO:0005634--C:nucleus
GO:0043291--C:RAVE complex
GO:0019005--C:SCF ubiquitin ligase complex
GO:0003688--F:DNA replication origin binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0010458--P:exit from mitosis
GO:0000082--P:G1/S transition of mitotic cell cycle
GO:0000086--P:G2/M transition of mitotic cell cycle
GO:0051382--P:kinetochore assembly
GO:2000766--P:negative regulation of cytoplasmic translation
GO:0045116--P:protein neddylation
GO:0042787--P:protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0007096--P:regulation of exit from mitosis
GO:0043254--P:regulation of protein complex assembly
GO:0031146--P:SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0000921--P:septin ring assembly
GO:0007035--P:vacuolar acidification

KEGG ppa:PAS_chr3_1258
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001036 Aegilops tauschii 44.62 8.00e-35 137.00
IUUC-Aml-002023 Ailuropoda melanoleuca 44.51 5.00e-34 134.00
IUUC-Atr-002858 Amborella trichopoda 45.16 2.00e-28 116.00
IUUC-Apl-003393 Anas platyrhynchos 44.51 5.00e-34 134.00
IUUC-Aca-004709 Anolis carolinensis 44.51 5.00e-34 134.00
IUUC-Aly-006236 Arabidopsis lyrata 42.93 9.00e-34 133.00
IUUC-Ath-007456 Arabidopsis thaliana 40.66 6.00e-33 130.00
IUUC-Ago-007847 Ashbya gossypii 59.14 7.00e-59 217.00
IUUC-Acl-008178 Aspergillus clavatus 54.95 3.00e-49 184.00
IUUC-Afl-008452 Aspergillus flavus 54.64 1.00e-47 179.00
IUUC-Afu-008785 Aspergillus fumigatus 56.59 4.00e-49 184.00
IUUC-Ani-009312 Aspergillus nidulans 51.89 4.00e-47 178.00
IUUC-Aor-010012 Aspergillus oryzae 54.64 1.00e-47 179.00
IUUC-Ate-010375 Aspergillus terreus 54.79 9.00e-50 186.00
IUUC-Ame-011025 Astyanax mexicanus 44.51 2.00e-34 135.00
IUUC-Bgr-012280 Blumeria graminis 51.14 7.00e-38 147.00
IUUC-Bta-013519 Bos taurus 44.51 5.00e-34 134.00
IUUC-Bci-013888 Botrytis cinerea 60.58 8.00e-30 120.00
IUUC-Bdi-014547 Brachypodium distachyon 48.28 6.00e-27 111.00
IUUC-Bol-015959 Brassica oleracea 40.32 4.00e-31 125.00
IUUC-Bra-017062 Brassica rapa 38.92 2.00e-19 86.30
IUUC-Cel-018653 Caenorhabditis elegans 45.16 7.00e-36 140.00
IUUC-Cja-019823 Callithrix jacchus 42.70 4.00e-30 121.00
IUUC-Cfa-020931 Canis familiaris 44.51 7.00e-34 134.00
IUUC-Cpo-022487 Cavia porcellus 56.03 9.00e-33 130.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 42.16 3.00e-29 118.00
IUUC-Csa-023459 Chlorocebus sabaeus 43.41 2.00e-33 132.00
IUUC-Cho-024854 Choloepus hoffmanni 45.90 5.00e-09 51.20
IUUC-Cin-025538 Ciona intestinalis 41.76 1.00e-32 129.00
IUUC-Csv-025865 Ciona savignyi 41.76 8.00e-36 140.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 52.60 5.00e-42 160.00
IUUC-Cne-027058 Cryptococcus neoformans 50.26 6.00e-48 181.00
IUUC-Cme-027174 Cyanidioschyzon merolae 35.71 1.00e-26 110.00
IUUC-Dre-027756 Danio rerio 44.51 2.00e-34 135.00
IUUC-Dno-028924 Dasypus novemcinctus 44.51 5.00e-34 134.00
IUUC-Dor-030847 Dipodomys ordii 41.44 4.00e-30 121.00
IUUC-Dse-031209 Dothistroma septosporum 51.35 8.00e-45 170.00
IUUC-Dme-032028 Drosophila melanogaster 44.51 2.00e-37 145.00
IUUC-Ete-033117 Echinops telfairi 41.76 1.00e-31 127.00
IUUC-Eca-033320 Equus caballus 44.51 5.00e-34 134.00
IUUC-Eeu-034817 Erinaceus europaeus 54.55 3.00e-08 47.00
IUUC-Fca-035423 Felis catus 44.51 5.00e-34 134.00
IUUC-Fal-036956 Ficedula albicollis 44.51 5.00e-34 134.00
IUUC-Fox-037761 Fusarium oxysporum 49.43 7.00e-41 157.00
IUUC-Fso-038451 Fusarium solani 49.71 6.00e-41 157.00
IUUC-Gmo-039178 Gadus morhua 44.51 4.00e-34 134.00
IUUC-Ggr-039831 Gaeumannomyces graminis 48.54 7.00e-39 150.00
IUUC-Gga-040238 Gallus gallus 44.51 5.00e-34 134.00
IUUC-Gac-041965 Gasterosteus aculeatus 44.51 4.00e-34 134.00
IUUC-Gma-043086 Glycine max 44.86 6.00e-34 134.00
IUUC-Ggo-045025 Gorilla gorilla 44.51 5.00e-34 134.00
IUUC-Hsa-046875 Homo sapiens 44.51 5.00e-34 134.00
IUUC-Hvu-047497 Hordeum vulgare 48.74 4.00e-29 118.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 42.86 1.00e-33 133.00
IUUC-Lch-050522 Latimeria chalumnae 48.04 7.00e-39 150.00
IUUC-Lpe-051330 Leersia perrieri 41.30 6.00e-33 130.00
IUUC-Loc-052596 Lepisosteus oculatus 44.51 4.00e-34 134.00
IUUC-Lma-053020 Leptosphaeria maculans 49.10 1.00e-35 139.00
IUUC-Laf-053847 Loxodonta africana 44.51 5.00e-34 134.00
IUUC-Mor-057176 Magnaporthe oryzae 47.95 6.00e-39 150.00
IUUC-Mpo-057471 Magnaporthe poae 48.54 8.00e-39 150.00
IUUC-Mtr-058461 Medicago truncatula 42.62 1.00e-35 139.00
IUUC-Mla-059153 Melampsora laricipopulina 54.10 2.00e-47 179.00
IUUC-Mga-059864 Meleagris gallopavo 44.51 5.00e-34 134.00
IUUC-Mvi-060342 Microbotryum violaceum 53.80 3.00e-50 188.00
IUUC-Mdo-062509 Monodelphis domestica 44.51 5.00e-34 134.00
IUUC-Mmu-063694 Mus musculus 44.51 4.00e-34 134.00
IUUC-Mac-064509 Musa acuminata 42.86 2.00e-32 130.00
IUUC-Mpu-065990 Mustela putorius furo 44.51 5.00e-34 134.00
IUUC-Mlu-068168 Myotis lucifugus 44.51 5.00e-34 134.00
IUUC-Nfi-068309 Neosartorya fischeri 56.59 4.00e-49 184.00
IUUC-Ncr-068658 Neurospora crassa 50.30 6.00e-42 160.00
IUUC-Nle-070101 Nomascus leucogenys 44.51 5.00e-34 134.00
IUUC-Opr-070881 Ochotona princeps 44.51 5.00e-34 134.00
IUUC-Ont-071529 Oreochromis niloticus 44.51 4.00e-34 134.00
IUUC-Oan-073000 Ornithorhynchus anatinus 65.52 1.00e-19 85.10
IUUC-Ocu-073780 Oryctolagus cuniculus 44.51 5.00e-34 134.00
IUUC-Oba-075110 Oryza barthii 39.44 1.00e-29 120.00
IUUC-Obr-076261 Oryza brachyantha 35.48 2.00e-29 119.00
IUUC-Ogl-076941 Oryza glaberrima 33.70 3.00e-25 105.00
IUUC-Ogu-078893 Oryza glumaepatula 34.57 4.00e-27 111.00
IUUC-Oin-080141 Oryza indica 37.50 1.00e-29 120.00
IUUC-Olo-080736 Oryza longistaminata 34.22 7.00e-28 114.00
IUUC-Ome-081685 Oryza meridionalis 50.00 1.00e-24 103.00
IUUC-Oni-082067 Oryza nivara 37.43 2.00e-26 109.00
IUUC-Opu-083972 Oryza punctata 35.87 1.00e-28 116.00
IUUC-Oru-084769 Oryza rufipogon 39.44 4.00e-30 121.00
IUUC-Osa-085479 Oryza sativa 39.44 4.00e-30 121.00
IUUC-Ola-087270 Oryzias latipes 44.51 4.00e-34 134.00
IUUC-Olu-087667 Ostreococcus lucimarinus 42.54 2.00e-31 125.00
IUUC-Oga-089073 Otolemur garnettii 44.51 5.00e-34 134.00
IUUC-Oar-089762 Ovis aries 43.78 7.00e-31 124.00
IUUC-Ptr-090872 Pan troglodytes 42.31 2.00e-32 129.00
IUUC-Pan-091780 Papio anubis 44.51 5.00e-34 134.00
IUUC-Psi-093135 Pelodiscus sinensis 44.51 5.00e-34 134.00
IUUC-Pno-094810 Phaeosphaeria nodorum 47.67 1.00e-35 140.00
IUUC-Ppa-095274 Physcomitrella patens 44.02 6.00e-32 127.00
IUUC-Pfo-097529 Poecilia formosa 44.51 4.00e-34 134.00
IUUC-Pab-098533 Pongo abelii 44.51 5.00e-34 134.00
IUUC-Pop-099897 Populus trichocarpa 46.77 4.00e-34 135.00
IUUC-Pca-100783 Procavia capensis 35.96 5.00e-24 101.00
IUUC-Ppe-101503 Prunus persica 47.06 7.00e-35 137.00
IUUC-Pva-102901 Pteropus vampyrus 44.51 5.00e-34 134.00
IUUC-Pgr-103499 Puccinia graminis 51.91 3.00e-46 175.00
IUUC-Ptt-103874 Puccinia triticina 64.41 7.00e-41 158.00
IUUC-Pte-104224 Pyrenophora teres 47.93 9.00e-32 127.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 48.85 3.00e-33 132.00
IUUC-Rno-105499 Rattus norvegicus 44.51 4.00e-34 135.00
IUUC-Sce-106387 Saccharomyces cerevisiae 58.95 7.00e-56 207.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 56.99 7.00e-53 197.00
IUUC-Spo-108033 Schizosaccharomyces pombe 54.05 5.00e-51 191.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 52.69 2.00e-43 166.00
IUUC-Smo-109307 Selaginella moellendorffii 45.36 3.00e-31 125.00
IUUC-Sit-110435 Setaria italica 38.58 7.00e-27 110.00
IUUC-Sly-111529 Solanum lycopersicum 44.86 2.00e-33 132.00
IUUC-Stu-111940 Solanum tuberosum 44.69 1.00e-31 126.00
IUUC-Sar-112973 Sorex araneus 56.60 8.00e-30 120.00
IUUC-Sbi-114394 Sorghum bicolor 50.41 5.00e-28 114.00
IUUC-Sre-115178 Sporisorium reilianum 53.01 4.00e-49 184.00
IUUC-Tgu-116474 Taeniopygia guttata 44.51 5.00e-34 134.00
IUUC-Tru-118429 Takifugu rubripes 45.05 4.00e-34 134.00
IUUC-Tsy-118896 Tarsius syrichta 44.51 5.00e-34 134.00
IUUC-Tni-119960 Tetraodon nigroviridis 45.05 4.00e-34 134.00
IUUC-Tca-121469 Theobroma cacao 46.74 1.00e-29 120.00
IUUC-Tre-122004 Trichoderma reesei 47.67 3.00e-37 145.00
IUUC-Tvi-122449 Trichoderma virens 48.52 2.00e-37 145.00
IUUC-Tae-125854 Triticum aestivum 44.62 8.00e-35 137.00
IUUC-Tur-126793 Triticum urartu 42.39 4.00e-34 134.00
IUUC-Tme-127078 Tuber melanosporum 53.26 4.00e-45 171.00
IUUC-Tbe-127720 Tupaia belangeri 44.51 5.00e-34 134.00
IUUC-Ttr-129035 Tursiops truncatus 44.51 5.00e-34 134.00
IUUC-Uma-129517 Ustilago maydis 51.91 2.00e-47 178.00
IUUC-Vda-129691 Verticillium dahliae 47.09 3.00e-38 148.00
IUUC-Vpa-130128 Vicugna pacos 44.51 4.00e-34 134.00
IUUC-Vvi-130876 Vitis vinifera 42.16 8.00e-35 137.00
IUUC-Xtr-132393 Xenopus tropicalis 44.51 5.00e-34 134.00
IUUC-Xma-133603 Xiphophorus maculatus 44.51 4.00e-34 134.00
IUUC-Yli-134499 Yarrowia lipolytica 54.55 3.00e-52 195.00
IUUC-Zma-135000 Zea mays 38.62 1.00e-27 113.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved