• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • PTM
    • dbPAF
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Ath-007460
UUCD1 version UUC-ArT-01424
Ensembl Protein ID AT4G15900.1
UniProt Accession Q42384; PRL1_ARATH
Genbank Protein ID CAA58031.1; CAA58032.1; CAB10369.1; CAB78632.1; AEE83664.1
Protein Name Protein pleiotropic regulatory locus 1; MOS4-associated complex protein 2
Genbank Nucleotide ID X82824; X82825; Z97339; AL161542; CP002687
Gene Name PRL1; MAC2; At4g15900; dl3990w; FCAALL.40
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
AT4G15900 AT4G15900.1 AT4G15900.1
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEOArrayExpress
Protein-protein Interaction
iRefIndexPINAHINTMentha
Protein Expression/Proteomics
GPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
E3 adaptor/Cullin RING/DCX/DWD WD_repeat 18223036
Classification
Family E-value Score Start End
E3 adaptor/Cullin RING/DCX/DWD 9.20e-44 146.4 174 210
UBD/Beta-Prp 1.10e-66 225.9 225 419
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/DCX/DWD

   S: 1    gHtdsvtclaf..sdtllvsGsdDgtikvWDlrtgvl 35
    gH ++v+++af s+ +++Gs D tik+WD+ tgvl
   Q: 174 GHLGWVRSVAFdpSNEWFCTGSADRTIKIWDVATGVL 210
    8***********54499******************97 PP
   


   UBD/Beta-Prp

   S: 17   kfspdksllatgsrdgtikvwdvttgkllrslsgheaevtavkfspdgkilvtgseDrtikvwdlstgkcvhtlkghedsvlslsfspsgdklvsGsh 114
    ++s+ ++++++++d+ +k wd+++ k++rs+ gh ++v+++ ++p+ ++l+tg++D + +vwd++t ++ +l+gh+++v+s+ p++ +v+Gsh
   Q: 225 AVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRVWDIRTKMQIFALSGHDNTVCSVFTRPTDPQVVTGSH 322
    5688999******************************************************************************************* PP
   S: 115 drtirvwdletgqcleetlsghdgvvncvvvhpdgnllvsGslDrtvrlWdlktgkllrtltgghtdsvyslsfdsngkelvsgsldgtvklwdlqtg 212
    d ti+ wdl+ g+ ++ tl+ h+++v+ +++hp++n ++s+s+D+t + ++l+ g+ + + ++++ ++ ++++++g +v+g+++g++ +wd ++g
   Q: 323 DTTIKFWDLRYGKTMS-TLTHHKKSVRAMTLHPKENAFASASADNTKK-FSLPKGEFCHNMLSQQKTIINAMAVNEDG-VMVTGGDNGSIWFWDWKSG 417
    ****************.*****************************99.99*999999999999************98.99***************99 PP
   S: 213 ec 214
    +
   Q: 418 HS 419
    74 PP
   

Organism Arabidopsis thaliana
Functional Description
(View)

Functional Description



     Pleiotropic regulator of glucose, stress and hormone responses. Also regulates cytochrome P450 CYP90A1/CPD. Coordinates the expression of hormone- and stress-related genes and genes related to cell wall modification and growth, leading to altered sugar-dependent growth and developmental responses. Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. By suppressing the expression of several (1)O(2)-responsive genes, PRL1 seems to play a major role in modulating responses of plants to environmental changes by interconnecting (1)O(2)-mediated retrograde signaling with other signaling pathways. Acts as negative regulator of SNF1-related protein kinases AKIN10 and AKIN11 via the inhibition of their interaction with SKP1/ASK1. Component of the CUL4-RBX1-DDB1-PRL1 E3 ubiquitin-protein ligase complex, PRL1 may function as the substrate recognition module within this complex, leading to the AKIN10 degradation.
Pleiotropic regulator of glucose, stress and hormone responses. Also regulates cytochrome P450 CYP90A1/CPD. Coordinates the expression of hormone- and stress-related genes and genes related to cell wall modification and growth, leading to altered sugar-dependent growth and developmental responses. Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. By suppressing the expression of several (1)O(2)-responsive genes, PRL1 seems to play a major role in modulating responses of plants to environmental changes by interconnecting (1)O(2)-mediated retrograde signaling with other signaling pathways. Acts as negative regulator of SNF1-related protein kinases AKIN10 and AKIN11 via the inhibition of their interaction with SKP1/ASK1. Component of the CUL4-RBX1-DDB1-PRL1 E3 ubiquitin-protein ligase complex, PRL1 may function as the substrate recognition module within this complex, leading to the AKIN10 degradation.
Protein Sequence
(Fasta)
MPAPTTEIEP IEAQSLKKLS LKSLKRSLEL FSPVHGQFPP PDPEAKQIRL SHKMKVAFGG 60
VEPVVSQPPR QPDRINEQPG PSNALSLAAP EGSKSTQKGA TESAIVVGPT LLRPILPKGL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ath-007460|E3,WD_repeat;UBD,Beta-Prp|Arabidopsis thaliana
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATTTTTCGGC GCAACAAAAT CGTGAAATTG ATATAAATAA ACTCGAGATT ATTAATATAA 60
CCCTTTTTCA CTTCACTTCT CTTTCTCTCT AAACCCTAAA AGAAGAACGA TGCCGGCTCC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ath-007460|E3,WD_repeat;UBD,Beta-Prp|Arabidopsis thaliana
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0391--Immunity
KW-0399--Innate immunity
KW-0539--Nucleus
KW-0611--Plant defense
KW-1185--Reference proteome
KW-0677--Repeat
KW-0833--Ubl conjugation pathway
KW-0853--WD repeat

Interpro

IPR020472--G-protein_beta_WD-40_rep
IPR015943--WD40/YVTN_repeat-like_dom
IPR001680--WD40_repeat
IPR019775--WD40_repeat_CS
IPR017986--WD40_repeat_dom

PROSITE

PS00678--WD_REPEATS_1
PS50082--WD_REPEATS_2
PS50294--WD_REPEATS_REGION

Pfam

PF00400--WD40

PRINTS

PR00320--GPROTEINBRPT

SMART

SM00320--WD40

Gene Ontology

GO:0071013--C:catalytic step 2 spliceosome
GO:0080008--C:Cul4-RING E3 ubiquitin ligase complex
GO:0005634--C:nucleus
GO:0071011--C:precatalytic spliceosome
GO:0000974--C:Prp19 complex
GO:0048825--P:cotyledon development
GO:0009870--P:defense response signaling pathway, resistance gene-dependent
GO:0010204--P:defense response signaling pathway, resistance gene-independent
GO:0042742--P:defense response to bacterium
GO:0050832--P:defense response to fungus
GO:0010154--P:fruit development
GO:0009755--P:hormone-mediated signaling pathway
GO:0045087--P:innate immune response
GO:0048366--P:leaf development
GO:0000398--P:mRNA splicing, via spliceosome
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:0016567--P:protein ubiquitination
GO:0006508--P:proteolysis
GO:0009749--P:response to glucose
GO:0048364--P:root development
GO:0010182--P:sugar mediated signaling pathway

KEGG ath:AT4G15900
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000084 Aegilops tauschii 68.24 0.00e+00 671.00
IUUC-Aml-001605 Ailuropoda melanoleuca 53.69 9.00e-127 446.00
IUUC-Atr-002757 Amborella trichopoda 69.34 0.00e+00 667.00
IUUC-Apl-003198 Anas platyrhynchos 53.45 4.00e-125 441.00
IUUC-Aca-004683 Anolis carolinensis 52.71 4.00e-125 441.00
IUUC-Aly-005775 Arabidopsis lyrata 96.50 0.00e+00 934.00
IUUC-Ago-007884 Ashbya gossypii 50.87 4.00e-104 370.00
IUUC-Acl-008153 Aspergillus clavatus 60.24 1.00e-118 419.00
IUUC-Afl-008384 Aspergillus flavus 60.54 3.00e-119 421.00
IUUC-Afu-009045 Aspergillus fumigatus 60.24 4.00e-118 417.00
IUUC-Ani-009229 Aspergillus nidulans 61.77 2.00e-118 418.00
IUUC-Ang-009812 Aspergillus niger 59.94 1.00e-110 391.00
IUUC-Aor-010059 Aspergillus oryzae 60.54 3.00e-119 421.00
IUUC-Ate-010351 Aspergillus terreus 60.84 9.00e-127 446.00
IUUC-Ame-011613 Astyanax mexicanus 41.11 1.00e-71 263.00
IUUC-Bgr-012042 Blumeria graminis 60.34 6.00e-130 456.00
IUUC-Bta-012406 Bos taurus 53.56 2.00e-125 441.00
IUUC-Bci-013760 Botrytis cinerea 56.96 1.00e-124 439.00
IUUC-Bdi-014776 Brachypodium distachyon 72.59 0.00e+00 689.00
IUUC-Bol-016189 Brassica oleracea 92.39 0.00e+00 904.00
IUUC-Bra-018044 Brassica rapa 92.39 0.00e+00 905.00
IUUC-Cel-018651 Caenorhabditis elegans 50.21 9.00e-129 452.00
IUUC-Cja-019974 Callithrix jacchus 52.58 8.00e-125 439.00
IUUC-Cfa-021085 Canis familiaris 54.26 8.00e-127 446.00
IUUC-Cpo-021458 Cavia porcellus 53.77 4.00e-126 444.00
IUUC-Cre-022880 Chlamydomonas reinhardtii 72.59 3.00e-157 546.00
IUUC-Csa-023883 Chlorocebus sabaeus 53.32 9.00e-126 442.00
IUUC-Cho-024623 Choloepus hoffmanni 52.83 2.00e-123 435.00
IUUC-Cin-025190 Ciona intestinalis 54.20 5.00e-126 443.00
IUUC-Csv-026367 Ciona savignyi 56.12 1.00e-126 445.00
IUUC-Cgl-026499 Colletotrichum gloeosporioides 60.98 1.00e-124 439.00
IUUC-Cne-027069 Cryptococcus neoformans 46.31 1.00e-114 406.00
IUUC-Cme-027233 Cyanidioschyzon merolae 29.27 4.00e-31 128.00
IUUC-Dre-028260 Danio rerio 62.57 1.00e-128 452.00
IUUC-Dno-029112 Dasypus novemcinctus 53.81 5.00e-127 447.00
IUUC-Dor-031118 Dipodomys ordii 57.58 1.00e-125 441.00
IUUC-Dse-031493 Dothistroma septosporum 58.81 2.00e-121 428.00
IUUC-Dme-032138 Drosophila melanogaster 47.84 5.00e-127 447.00
IUUC-Ete-032411 Echinops telfairi 52.54 3.00e-101 361.00
IUUC-Eca-033521 Equus caballus 52.83 4.00e-126 444.00
IUUC-Eeu-035249 Erinaceus europaeus 49.03 8.00e-98 350.00
IUUC-Fca-036358 Felis catus 53.45 4.00e-126 444.00
IUUC-Fal-036933 Ficedula albicollis 53.20 2.00e-125 441.00
IUUC-Fox-037713 Fusarium oxysporum 54.86 1.00e-126 445.00
IUUC-Fso-038380 Fusarium solani 62.31 2.00e-126 444.00
IUUC-Gmo-039133 Gadus morhua 47.42 1.00e-127 449.00
IUUC-Ggr-039915 Gaeumannomyces graminis 60.79 3.00e-119 421.00
IUUC-Gga-041176 Gallus gallus 60.96 3.00e-124 437.00
IUUC-Gac-042344 Gasterosteus aculeatus 47.93 6.00e-128 450.00
IUUC-Gma-043328 Glycine max 79.17 0.00e+00 775.00
IUUC-Ggo-044478 Gorilla gorilla 53.07 1.00e-125 442.00
IUUC-Hsa-046037 Homo sapiens 53.07 2.00e-125 441.00
IUUC-Hvu-047349 Hordeum vulgare 72.43 0.00e+00 693.00
IUUC-Itr-048390 Ictidomys tridecemlineatus 52.83 3.00e-126 444.00
IUUC-Kpa-049343 Komagataella pastoris 56.07 5.00e-115 407.00
IUUC-Lch-049830 Latimeria chalumnae 57.06 7.00e-125 440.00
IUUC-Lpe-051442 Leersia perrieri 72.08 0.00e+00 689.00
IUUC-Loc-051794 Lepisosteus oculatus 62.11 2.00e-122 431.00
IUUC-Lma-053137 Leptosphaeria maculans 57.10 2.00e-121 428.00
IUUC-Laf-053471 Loxodonta africana 53.43 1.00e-126 446.00
IUUC-Mcc-055627 Macaca mulatta 53.32 1.00e-125 442.00
IUUC-Meu-056148 Macropus eugenii 57.96 6.00e-120 423.00
IUUC-Mor-056960 Magnaporthe oryzae 60.67 1.00e-123 436.00
IUUC-Mtr-057816 Medicago truncatula 75.57 0.00e+00 745.00
IUUC-Mla-059031 Melampsora laricipopulina 60.12 4.00e-116 410.00
IUUC-Mga-059337 Meleagris gallopavo 60.96 5.00e-124 437.00
IUUC-Mvi-060217 Microbotryum violaceum 57.47 4.00e-118 417.00
IUUC-Mmr-061018 Microcebus murinus 52.94 1.00e-125 442.00
IUUC-Mdo-062863 Monodelphis domestica 61.13 8.00e-122 429.00
IUUC-Mmu-063988 Mus musculus 60.53 4.00e-125 440.00
IUUC-Mac-064459 Musa acuminata 71.28 0.00e+00 660.00
IUUC-Mpu-066559 Mustela putorius furo 53.90 3.00e-126 444.00
IUUC-Mlu-067361 Myotis lucifugus 59.64 8.00e-125 439.00
IUUC-Nfi-068492 Neosartorya fischeri 59.94 6.00e-118 416.00
IUUC-Ncr-068808 Neurospora crassa 60.49 8.00e-125 439.00
IUUC-Nle-069875 Nomascus leucogenys 53.07 1.00e-125 442.00
IUUC-Opr-070462 Ochotona princeps 58.80 3.00e-95 341.00
IUUC-Ont-071365 Oreochromis niloticus 62.16 2.00e-128 452.00
IUUC-Oan-072708 Ornithorhynchus anatinus 52.71 6.00e-125 440.00
IUUC-Ocu-074594 Oryctolagus cuniculus 52.94 7.00e-126 443.00
IUUC-Oba-075570 Oryza barthii 72.38 0.00e+00 680.00
IUUC-Obr-076366 Oryza brachyantha 87.87 8.00e-131 458.00
IUUC-Ogl-077153 Oryza glaberrima 72.18 0.00e+00 675.00
IUUC-Ogu-078540 Oryza glumaepatula 72.38 0.00e+00 679.00
IUUC-Oin-079612 Oryza indica 71.64 0.00e+00 674.00
IUUC-Olo-081077 Oryza longistaminata 71.64 0.00e+00 674.00
IUUC-Ome-081236 Oryza meridionalis 71.43 0.00e+00 673.00
IUUC-Oni-082499 Oryza nivara 72.38 0.00e+00 679.00
IUUC-Opu-083499 Oryza punctata 72.11 0.00e+00 671.00
IUUC-Oru-084276 Oryza rufipogon 72.38 0.00e+00 679.00
IUUC-Osa-085849 Oryza sativa 72.38 0.00e+00 679.00
IUUC-Ola-086655 Oryzias latipes 61.93 1.00e-127 449.00
IUUC-Olu-087637 Ostreococcus lucimarinus 64.75 1.00e-145 508.00
IUUC-Oga-087934 Otolemur garnettii 52.96 2.00e-125 441.00
IUUC-Oar-090185 Ovis aries 59.94 2.00e-125 441.00
IUUC-Ptr-091198 Pan troglodytes 53.07 1.00e-125 442.00
IUUC-Pan-092622 Papio anubis 53.32 9.00e-126 442.00
IUUC-Psi-093320 Pelodiscus sinensis 52.96 3.00e-124 437.00
IUUC-Pma-094638 Petromyzon marinus 49.78 2.00e-127 448.00
IUUC-Pno-094826 Phaeosphaeria nodorum 50.43 2.00e-101 362.00
IUUC-Ppa-095576 Physcomitrella patens 64.87 1.00e-169 588.00
IUUC-Pfo-096894 Poecilia formosa 62.16 7.00e-128 449.00
IUUC-Pab-098020 Pongo abelii 53.07 1.00e-125 442.00
IUUC-Pop-099180 Populus trichocarpa 75.93 0.00e+00 729.00
IUUC-Pca-100909 Procavia capensis 52.77 8.00e-99 353.00
IUUC-Ppe-101346 Prunus persica 76.81 0.00e+00 742.00
IUUC-Pva-102167 Pteropus vampyrus 48.18 5.00e-107 380.00
IUUC-Pgr-103516 Puccinia graminis 58.20 1.00e-113 402.00
IUUC-Ptt-103738 Puccinia triticina 58.59 4.00e-114 404.00
IUUC-Pte-104352 Pyrenophora teres 58.88 1.00e-124 439.00
IUUC-Pyt-104632 Pyrenophora triticirepentis 58.58 1.00e-124 439.00
IUUC-Rno-105291 Rattus norvegicus 54.05 2.00e-126 444.00
IUUC-Sce-106204 Saccharomyces cerevisiae 53.33 1.00e-106 379.00
IUUC-Sha-106943 Sarcophilus harrisii 59.69 2.00e-118 419.00
IUUC-Sja-107659 Schizosaccharomyces japonicus 61.96 3.00e-120 424.00
IUUC-Spo-108049 Schizosaccharomyces pombe 61.88 4.00e-124 437.00
IUUC-Smo-109043 Selaginella moellendorffii 80.35 1.00e-175 608.00
IUUC-Sit-110431 Setaria italica 73.17 0.00e+00 691.00
IUUC-Sly-111391 Solanum lycopersicum 74.49 0.00e+00 684.00
IUUC-Stu-112364 Solanum tuberosum 71.71 3.00e-131 460.00
IUUC-Sar-113450 Sorex araneus 60.06 2.00e-123 435.00
IUUC-Sbi-113829 Sorghum bicolor 72.54 0.00e+00 690.00
IUUC-Sre-115153 Sporisorium reilianum 55.21 3.00e-109 388.00
IUUC-Ssc-116274 Sus scrofa 53.45 9.00e-126 442.00
IUUC-Tgu-117417 Taeniopygia guttata 60.66 5.00e-125 440.00
IUUC-Tru-117615 Takifugu rubripes 47.30 7.00e-121 426.00
IUUC-Tsy-119480 Tarsius syrichta 53.56 8.00e-127 446.00
IUUC-Tni-119847 Tetraodon nigroviridis 60.84 3.00e-126 444.00
IUUC-Tca-121287 Theobroma cacao 76.17 0.00e+00 768.00
IUUC-Tre-122010 Trichoderma reesei 60.98 1.00e-123 436.00
IUUC-Tvi-122475 Trichoderma virens 60.98 9.00e-124 436.00
IUUC-Tae-124397 Triticum aestivum 72.13 0.00e+00 696.00
IUUC-Tur-126116 Triticum urartu 62.00 9.00e-158 549.00
IUUC-Tme-126992 Tuber melanosporum 58.33 1.00e-125 442.00
IUUC-Tbe-127803 Tupaia belangeri 53.15 8.00e-96 343.00
IUUC-Ttr-128933 Tursiops truncatus 52.96 2.00e-125 441.00
IUUC-Uma-129447 Ustilago maydis 54.83 6.00e-109 387.00
IUUC-Vda-129780 Verticillium dahliae 60.06 2.00e-124 438.00
IUUC-Vpa-130557 Vicugna pacos 42.78 4.00e-44 171.00
IUUC-Vvi-130918 Vitis vinifera 77.30 0.00e+00 752.00
IUUC-Xtr-132409 Xenopus tropicalis 59.76 2.00e-123 435.00
IUUC-Xma-133420 Xiphophorus maculatus 62.16 3.00e-128 451.00
IUUC-Yli-134362 Yarrowia lipolytica 54.05 2.00e-120 425.00
IUUC-Zma-135804 Zea mays 71.37 0.00e+00 670.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved