• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • Proteomics

Tag Content
UUCD2 ID IUUC-Bdi-014138
UUCD1 version UUC-BrD-01458
Ensembl Protein ID BRADI4G07420.1
UniProt Accession I1IIF3; I1IIF3_BRADI
Genbank Protein ID KQJ86729.1
Protein Name Defective in cullin neddylation protein
Genbank Nucleotide ID CM000883
Gene Name LOC100840145; BRADI_4g07420
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
BRADI4G07420 BRADI4G07420.1 BRADI4G07420.1
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/DCUN1 1.20e-82 277.1 54 240
UBD/Alpha-Helix/UBA 4.30e-08 33.6 10 46
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/DCUN1

   S: 2    skkkleelferYkdpqedligieglekfcedlgvdpediavLvlawkleaatlcefsreefldgltalgcdsieklqeklktleselkdeqkfkd 96
    ++++le+l++rYk+ + d+i +eg +++c+dl vdp+d+++Lv++w+++aat+cef+r+ef+dgl+++g+dsiekl+ekl++l+ e+kd +kf++
   Q: 54 NSRHLEDLYNRYKERDADMIMVEGTSQLCNDLLVDPQDVVMLVISWHMKAATMCEFTRQEFFDGLQSIGVDSIEKLREKLPSLRAEIKDDHKFRE 148
    5799******************************************************************************************* PP
   S: 97 iYrfafnfakdkgqksldldtaialwkLllaerefklldawlkfLeeekkksiskDtWnllLefskviakdlsnYdeegaWPvliDefveyl 188
    iY+faf +a++kgqksl+l+tai +w+Ll+++r+++l+d+w++fL+ +++k+is+DtW +lLef k+i+++l nYdeegaWP+liDefveyl
   Q: 149 IYNFAFAWAREKGQKSLALETAIGMWRLLFDGRHWPLIDHWCQFLQVKHNKAISRDTWSQLLEFVKTIDPQLTNYDEEGAWPYLIDEFVEYL 240
    ******************************************************************************************96 PP
   


   UBD/Alpha-Helix/UBA

   S: 5    dkleqlve.MGFdreealqaLraannnleaAveyLld 40
    +k++q+++ +G +++ alqaL a++++le A +y+++
   Q: 10 EKVQQFMAiTGASEKVALQALKASDWHLEGAFDYFYS 46
    79*********************************97 PP
   

Organism Brachypodium distachyon
Functional Description
(View)

Functional Description



     Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Protein Sequence
(Fasta)
MHKLGRGSRE KVQQFMAITG ASEKVALQAL KASDWHLEGA FDYFYSQPQV SVANSRHLED 60
LYNRYKERDA DMIMVEGTSQ LCNDLLVDPQ DVVMLVISWH MKAATMCEFT RQEFFDGLQS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Bdi-014138|E3,DCUN1;UBD,UBA|Brachypodium distachyon
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GCAGAGGGTG GACGAGCCTC CCTGCTCCCC TCTCGCGGTC GCGTCCCCCG GCGACCCTCT 60
CCGGCGACGC TCCGCCGATC GTTTGCGGCC CCACCGCTCC TCGCGACCAG ATCGGAGGCC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Bdi-014138|E3,DCUN1;UBD,UBA|Brachypodium distachyon
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR014764--DCN-prot
IPR005176--PONY_dom
IPR009060--UBA-like

PROSITE

PS51229--DCUN1

Pfam

PF03556--Cullin_binding

Gene Ontology

GO:0000151--C:ubiquitin ligase complex
GO:0097602--F:cullin family protein binding
GO:0031624--F:ubiquitin conjugating enzyme binding
GO:0032182--F:ubiquitin-like protein binding
GO:0051443--P:positive regulation of ubiquitin-protein transferase activity
GO:0045116--P:protein neddylation

KEGG bdi:100822780
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000561 Aegilops tauschii 94.80 1.00e-143 501.00
IUUC-Aml-001879 Ailuropoda melanoleuca 43.50 1.00e-61 228.00
IUUC-Atr-002697 Amborella trichopoda 68.50 9.00e-50 187.00
IUUC-Apl-003933 Anas platyrhynchos 45.12 6.00e-61 226.00
IUUC-Aca-005269 Anolis carolinensis 44.13 4.00e-61 227.00
IUUC-Aly-006285 Arabidopsis lyrata 62.90 5.00e-90 322.00
IUUC-Ath-007531 Arabidopsis thaliana 70.00 6.00e-106 375.00
IUUC-Ago-007806 Ashbya gossypii 26.23 1.00e-18 85.50
IUUC-Acl-008172 Aspergillus clavatus 27.95 5.00e-28 117.00
IUUC-Afl-008569 Aspergillus flavus 31.98 5.00e-35 140.00
IUUC-Afu-009005 Aspergillus fumigatus 28.90 3.00e-20 90.50
IUUC-Ani-009241 Aspergillus nidulans 25.00 2.00e-24 105.00
IUUC-Ang-009664 Aspergillus niger 30.99 2.00e-30 124.00
IUUC-Aor-009902 Aspergillus oryzae 27.91 3.00e-12 63.20
IUUC-Ate-010414 Aspergillus terreus 29.96 1.00e-33 135.00
IUUC-Ame-011763 Astyanax mexicanus 45.12 1.00e-61 229.00
IUUC-Bgr-011991 Blumeria graminis 32.39 1.00e-24 106.00
IUUC-Bta-013561 Bos taurus 43.10 5.00e-57 213.00
IUUC-Bci-013824 Botrytis cinerea 34.66 4.00e-34 137.00
IUUC-Bol-016110 Brassica oleracea 69.08 2.00e-104 370.00
IUUC-Bra-017111 Brassica rapa 69.08 1.00e-104 371.00
IUUC-Cel-018441 Caenorhabditis elegans 33.33 2.00e-38 152.00
IUUC-Cja-018854 Callithrix jacchus 45.12 1.00e-61 229.00
IUUC-Cfa-020523 Canis familiaris 43.53 1.00e-57 215.00
IUUC-Cpo-021832 Cavia porcellus 45.16 2.00e-61 228.00
IUUC-Cre-022620 Chlamydomonas reinhardtii 46.09 1.00e-65 242.00
IUUC-Csa-023551 Chlorocebus sabaeus 43.72 3.00e-62 230.00
IUUC-Cho-024373 Choloepus hoffmanni 43.09 8.00e-58 216.00
IUUC-Cin-025269 Ciona intestinalis 45.75 3.00e-62 230.00
IUUC-Csv-025976 Ciona savignyi 36.77 5.00e-34 137.00
IUUC-Cgl-026386 Colletotrichum gloeosporioides 32.04 2.00e-22 97.80
IUUC-Cne-026950 Cryptococcus neoformans 35.63 2.00e-38 151.00
IUUC-Cme-027199 Cyanidioschyzon merolae 28.08 2.00e-07 48.50
IUUC-Dre-028247 Danio rerio 44.72 2.00e-61 228.00
IUUC-Dno-028974 Dasypus novemcinctus 43.72 3.00e-62 230.00
IUUC-Dor-030143 Dipodomys ordii 45.93 1.00e-61 228.00
IUUC-Dse-031365 Dothistroma septosporum 27.94 9.00e-28 116.00
IUUC-Dme-032197 Drosophila melanogaster 41.60 1.00e-54 205.00
IUUC-Ete-032371 Echinops telfairi 43.50 1.00e-61 228.00
IUUC-Eca-033242 Equus caballus 43.50 1.00e-61 228.00
IUUC-Eeu-035317 Erinaceus europaeus 43.90 7.00e-62 229.00
IUUC-Fca-036061 Felis catus 43.32 1.00e-61 229.00
IUUC-Fal-036715 Ficedula albicollis 45.12 5.00e-61 226.00
IUUC-Fox-037884 Fusarium oxysporum 32.03 2.00e-16 77.40
IUUC-Fso-038150 Fusarium solani 30.73 6.00e-20 90.50
IUUC-Gmo-038885 Gadus morhua 45.53 1.00e-62 231.00
IUUC-Ggr-039959 Gaeumannomyces graminis 25.84 6.00e-16 78.60
IUUC-Gga-040935 Gallus gallus 43.32 1.00e-61 229.00
IUUC-Gac-041478 Gasterosteus aculeatus 45.12 4.00e-61 226.00
IUUC-Gma-043545 Glycine max 72.98 7.00e-115 405.00
IUUC-Ggo-044972 Gorilla gorilla 44.94 7.00e-62 229.00
IUUC-Hsa-046994 Homo sapiens 45.34 4.00e-62 230.00
IUUC-Hvu-047636 Hordeum vulgare 38.40 3.00e-22 97.10
IUUC-Itr-047902 Ictidomys tridecemlineatus 46.34 2.00e-62 231.00
IUUC-Kpa-049127 Komagataella pastoris 28.40 7.00e-29 119.00
IUUC-Lch-049751 Latimeria chalumnae 47.37 1.00e-62 232.00
IUUC-Lpe-051540 Leersia perrieri 91.16 2.00e-137 480.00
IUUC-Loc-052509 Lepisosteus oculatus 44.94 4.00e-62 230.00
IUUC-Lma-053103 Leptosphaeria maculans 28.69 1.00e-26 112.00
IUUC-Laf-053972 Loxodonta africana 46.75 3.00e-62 230.00
IUUC-Mcc-054700 Macaca mulatta 44.94 4.00e-62 230.00
IUUC-Meu-056535 Macropus eugenii 43.98 1.00e-46 179.00
IUUC-Mor-056909 Magnaporthe oryzae 29.12 6.00e-24 103.00
IUUC-Mpo-057299 Magnaporthe poae 25.65 1.00e-19 89.40
IUUC-Mtr-057964 Medicago truncatula 72.18 5.00e-113 399.00
IUUC-Mla-058990 Melampsora laricipopulina 28.36 2.00e-19 89.00
IUUC-Mga-060072 Meleagris gallopavo 45.53 3.00e-61 227.00
IUUC-Mvi-060312 Microbotryum violaceum 35.27 4.00e-42 163.00
IUUC-Mmr-060851 Microcebus murinus 43.50 2.00e-61 228.00
IUUC-Mdo-063074 Monodelphis domestica 43.50 7.00e-61 228.00
IUUC-Mmu-063816 Mus musculus 45.34 1.00e-62 231.00
IUUC-Mac-065016 Musa acuminata 78.77 4.00e-87 312.00
IUUC-Mpu-066870 Mustela putorius furo 43.53 1.00e-57 215.00
IUUC-Mlu-067701 Myotis lucifugus 43.09 2.00e-60 224.00
IUUC-Nfi-068610 Neosartorya fischeri 28.90 4.00e-20 90.10
IUUC-Ncr-068780 Neurospora crassa 24.63 2.00e-17 82.40
IUUC-Nle-069291 Nomascus leucogenys 43.72 3.00e-62 230.00
IUUC-Opr-070682 Ochotona princeps 45.21 9.00e-48 182.00
IUUC-Ont-071813 Oreochromis niloticus 45.53 8.00e-62 229.00
IUUC-Oan-073031 Ornithorhynchus anatinus 43.90 1.00e-61 229.00
IUUC-Ocu-074648 Oryctolagus cuniculus 43.50 1.00e-61 228.00
IUUC-Oba-074993 Oryza barthii 90.40 7.00e-137 478.00
IUUC-Obr-076341 Oryza brachyantha 88.00 7.00e-134 468.00
IUUC-Ogl-077099 Oryza glaberrima 90.40 7.00e-137 478.00
IUUC-Ogu-078285 Oryza glumaepatula 90.00 7.00e-136 475.00
IUUC-Oin-079441 Oryza indica 90.80 2.00e-137 480.00
IUUC-Olo-081037 Oryza longistaminata 90.80 2.00e-137 480.00
IUUC-Ome-081357 Oryza meridionalis 90.80 2.00e-137 480.00
IUUC-Oni-082632 Oryza nivara 90.80 2.00e-137 480.00
IUUC-Opu-083351 Oryza punctata 90.64 1.00e-128 451.00
IUUC-Oru-084306 Oryza rufipogon 90.80 2.00e-137 480.00
IUUC-Osa-085307 Oryza sativa 90.80 2.00e-137 480.00
IUUC-Ola-086371 Oryzias latipes 45.12 7.00e-62 229.00
IUUC-Olu-087646 Ostreococcus lucimarinus 41.46 1.00e-50 192.00
IUUC-Oga-089015 Otolemur garnettii 43.09 6.00e-61 226.00
IUUC-Oar-090405 Ovis aries 43.09 6.00e-61 226.00
IUUC-Ptr-090735 Pan troglodytes 43.50 1.00e-61 228.00
IUUC-Pan-092825 Papio anubis 44.94 4.00e-62 230.00
IUUC-Psi-093110 Pelodiscus sinensis 43.10 8.00e-57 212.00
IUUC-Pma-094196 Petromyzon marinus 39.78 2.00e-43 168.00
IUUC-Pno-095145 Phaeosphaeria nodorum 31.31 2.00e-24 105.00
IUUC-Ppa-095321 Physcomitrella patens 72.40 1.00e-108 384.00
IUUC-Pfo-097121 Poecilia formosa 44.72 5.00e-61 227.00
IUUC-Pab-098197 Pongo abelii 44.40 1.00e-56 212.00
IUUC-Pop-098821 Populus trichocarpa 76.11 3.00e-53 199.00
IUUC-Pca-100218 Procavia capensis 43.09 5.00e-61 226.00
IUUC-Ppe-102032 Prunus persica 74.70 6.00e-117 412.00
IUUC-Pva-102691 Pteropus vampyrus 45.34 3.00e-62 230.00
IUUC-Pgr-103633 Puccinia graminis 28.57 5.00e-21 94.00
IUUC-Ptt-103979 Puccinia triticina 35.71 8.00e-05 40.80
IUUC-Pyt-104428 Pyrenophora triticirepentis 29.27 3.00e-24 104.00
IUUC-Rno-105016 Rattus norvegicus 45.75 6.00e-63 233.00
IUUC-Sce-106358 Saccharomyces cerevisiae 25.10 8.00e-19 86.70
IUUC-Sha-106888 Sarcophilus harrisii 43.50 2.00e-61 228.00
IUUC-Sja-107938 Schizosaccharomyces japonicus 28.87 6.00e-23 100.00
IUUC-Spo-108207 Schizosaccharomyces pombe 34.17 8.00e-27 112.00
IUUC-Ssl-108410 Sclerotinia sclerotiorum 33.20 4.00e-34 137.00
IUUC-Smo-108750 Selaginella moellendorffii 66.12 3.00e-92 330.00
IUUC-Sit-110052 Setaria italica 88.40 1.00e-134 471.00
IUUC-Sly-111489 Solanum lycopersicum 76.11 3.00e-115 406.00
IUUC-Stu-112517 Solanum tuberosum 59.20 1.00e-92 331.00
IUUC-Sar-113509 Sorex araneus 41.86 7.00e-40 156.00
IUUC-Sbi-114113 Sorghum bicolor 88.40 8.00e-134 468.00
IUUC-Sre-115221 Sporisorium reilianum 27.46 1.00e-26 112.00
IUUC-Ssc-115547 Sus scrofa 43.72 3.00e-62 230.00
IUUC-Tgu-117196 Taeniopygia guttata 45.12 5.00e-61 226.00
IUUC-Tru-117740 Takifugu rubripes 44.49 7.00e-61 226.00
IUUC-Tsy-119599 Tarsius syrichta 43.50 1.00e-61 228.00
IUUC-Tni-120315 Tetraodon nigroviridis 43.50 5.00e-60 223.00
IUUC-Tca-121033 Theobroma cacao 73.31 1.00e-116 411.00
IUUC-Tre-121986 Trichoderma reesei 26.28 7.00e-21 93.60
IUUC-Tvi-122607 Trichoderma virens 32.68 1.00e-27 115.00
IUUC-Tae-125740 Triticum aestivum 81.44 3.00e-138 483.00
IUUC-Tur-126375 Triticum urartu 73.44 2.00e-132 464.00
IUUC-Tme-126878 Tuber melanosporum 33.33 6.00e-36 144.00
IUUC-Tbe-127429 Tupaia belangeri 43.94 4.00e-48 184.00
IUUC-Ttr-129086 Tursiops truncatus 38.62 1.00e-50 192.00
IUUC-Uma-129364 Ustilago maydis 28.43 7.00e-33 133.00
IUUC-Vda-129929 Verticillium dahliae 33.70 3.00e-21 95.50
IUUC-Vpa-130048 Vicugna pacos 37.80 3.00e-48 184.00
IUUC-Vvi-130834 Vitis vinifera 74.70 1.00e-115 408.00
IUUC-Xtr-131888 Xenopus tropicalis 44.31 2.00e-61 228.00
IUUC-Xma-133580 Xiphophorus maculatus 45.34 3.00e-62 230.00
IUUC-Yli-134595 Yarrowia lipolytica 34.30 3.00e-39 154.00
IUUC-Zma-135642 Zea mays 86.00 3.00e-132 462.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved