• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • PTM
    • CPLM
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Laf-053766
Ensembl Protein ID ENSLAFP00000003068.2
UniProt Accession G3SSV7; G3SSV7_LOXAF
Protein Name Uncharacterized protein
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSLAFG00000003682.2 ENSLAFT00000003684.2 ENSLAFP00000003068.2
ENSLAFG00000003682.2 ENSLAFT00000033228.1 ENSLAFP00000025845.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 3.30e-68 228.3 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    Avses+lkk++skyk+++ltvre++n+i+ yk+lkp+++s+v+nDg+sreL++ltGtipvp+rg+tynipi+lwll+tYP++PP+++vk
   Q: 2 AVSESQLKKMVSKYKYRDLTVRETINVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVK 90
    89*************************************************************************************** PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 91 PTSSM-TIKTG-KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Loxodonta africana
Protein Sequence
(Fasta)
MAVSESQLKK MVSKYKYRDL TVRETINVIT LYKDLKPVLD SYVFNDGSSR ELMNLTGTIP 60
VPYRGNTYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Laf-053766|UBD,UBD_UEV|Loxodonta africana
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGCGGTGT CGGAAAGCCA GCTCAAGAAA ATGGTGTCCA AGGTGAGGCC CGCGGCGCGC 60
GGTGTCCGCT CCCTTCACCT CCTGGCCCGG TTCATCTCGG CCCAGCGAGC CTCTCCCGTG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Laf-053766|UBD,UBD_UEV|Loxodonta africana
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

KEGG lav:100667684
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 27.35 1.00e-26 114.00
IUUC-Aml-002415 Ailuropoda melanoleuca 97.95 0.00e+00 731.00
IUUC-Atr-002875 Amborella trichopoda 29.51 7.00e-38 151.00
IUUC-Apl-003473 Anas platyrhynchos 88.52 0.00e+00 684.00
IUUC-Aca-004573 Anolis carolinensis 90.56 0.00e+00 671.00
IUUC-Aly-006164 Arabidopsis lyrata 44.12 5.00e-22 98.60
IUUC-Ath-006575 Arabidopsis thaliana 31.17 4.00e-32 132.00
IUUC-Ago-007755 Ashbya gossypii 25.00 4.00e-05 42.70
IUUC-Acl-008218 Aspergillus clavatus 38.76 4.00e-25 109.00
IUUC-Afl-008597 Aspergillus flavus 38.57 3.00e-25 110.00
IUUC-Afu-009017 Aspergillus fumigatus 37.98 4.00e-23 102.00
IUUC-Ani-009468 Aspergillus nidulans 38.64 8.00e-21 95.10
IUUC-Ang-009755 Aspergillus niger 36.51 3.00e-22 100.00
IUUC-Aor-010072 Aspergillus oryzae 37.14 2.00e-25 110.00
IUUC-Ate-010400 Aspergillus terreus 37.98 1.00e-24 107.00
IUUC-Ame-011620 Astyanax mexicanus 80.00 0.00e+00 637.00
IUUC-Bgr-012136 Blumeria graminis 35.77 1.00e-23 104.00
IUUC-Bta-012557 Bos taurus 98.21 0.00e+00 753.00
IUUC-Bci-013881 Botrytis cinerea 35.92 4.00e-26 112.00
IUUC-Bdi-014325 Brachypodium distachyon 32.11 2.00e-14 72.80
IUUC-Bol-016308 Brassica oleracea 41.60 1.00e-26 114.00
IUUC-Bra-017442 Brassica rapa 42.37 3.00e-24 105.00
IUUC-Cel-018697 Caenorhabditis elegans 49.61 3.00e-37 149.00
IUUC-Cja-018963 Callithrix jacchus 91.84 0.00e+00 726.00
IUUC-Cfa-020472 Canis familiaris 97.95 0.00e+00 729.00
IUUC-Cpo-022001 Cavia porcellus 99.23 0.00e+00 738.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 29.81 4.00e-31 129.00
IUUC-Csa-023959 Chlorocebus sabaeus 98.47 0.00e+00 703.00
IUUC-Cho-024389 Choloepus hoffmanni 56.36 4.00e-38 152.00
IUUC-Cin-025688 Ciona intestinalis 44.27 2.00e-98 352.00
IUUC-Cne-026904 Cryptococcus neoformans 27.69 2.00e-15 77.00
IUUC-Cme-027280 Cyanidioschyzon merolae 39.09 1.00e-17 83.60
IUUC-Dre-027913 Danio rerio 80.26 4.00e-175 607.00
IUUC-Dno-029672 Dasypus novemcinctus 97.70 0.00e+00 739.00
IUUC-Dor-030175 Dipodomys ordii 98.00 3.00e-94 338.00
IUUC-Dse-031375 Dothistroma septosporum 30.29 6.00e-23 102.00
IUUC-Dme-031736 Drosophila melanogaster 47.60 2.00e-98 352.00
IUUC-Ete-032343 Echinops telfairi 92.84 0.00e+00 697.00
IUUC-Eca-033926 Equus caballus 98.47 0.00e+00 728.00
IUUC-Eeu-034940 Erinaceus europaeus 90.28 0.00e+00 716.00
IUUC-Fca-035491 Felis catus 97.19 0.00e+00 712.00
IUUC-Fal-037508 Ficedula albicollis 90.82 0.00e+00 682.00
IUUC-Fox-037937 Fusarium oxysporum 32.31 4.00e-21 95.90
IUUC-Fso-038091 Fusarium solani 36.03 7.00e-25 108.00
IUUC-Gmo-039427 Gadus morhua 78.97 2.00e-170 591.00
IUUC-Ggr-039724 Gaeumannomyces graminis 37.31 8.00e-25 108.00
IUUC-Gga-040998 Gallus gallus 89.80 0.00e+00 710.00
IUUC-Gac-041356 Gasterosteus aculeatus 80.20 0.00e+00 637.00
IUUC-Gma-044361 Glycine max 38.89 8.00e-25 107.00
IUUC-Ggo-044967 Gorilla gorilla 98.47 0.00e+00 703.00
IUUC-Hsa-046686 Homo sapiens 98.47 0.00e+00 703.00
IUUC-Hvu-047430 Hordeum vulgare 28.17 2.00e-26 113.00
IUUC-Itr-047929 Ictidomys tridecemlineatus 98.66 5.00e-111 393.00
IUUC-Kpa-049287 Komagataella pastoris 30.86 1.00e-15 77.80
IUUC-Lch-050597 Latimeria chalumnae 86.99 0.00e+00 705.00
IUUC-Lpe-051090 Leersia perrieri 39.13 3.00e-20 92.40
IUUC-Loc-052399 Lepisosteus oculatus 80.82 9.00e-178 615.00
IUUC-Lma-053249 Leptosphaeria maculans 29.82 1.00e-13 71.20
IUUC-Mcc-055641 Macaca mulatta 98.47 0.00e+00 703.00
IUUC-Meu-055919 Macropus eugenii 90.49 1.00e-169 588.00
IUUC-Mor-056970 Magnaporthe oryzae 38.46 8.00e-24 105.00
IUUC-Mpo-057345 Magnaporthe poae 36.92 1.00e-22 100.00
IUUC-Mtr-058436 Medicago truncatula 27.88 1.00e-32 134.00
IUUC-Mla-059037 Melampsora laricipopulina 35.86 2.00e-25 110.00
IUUC-Mga-059263 Meleagris gallopavo 89.09 0.00e+00 687.00
IUUC-Mvi-060463 Microbotryum violaceum 29.56 2.00e-17 84.30
IUUC-Mmr-060915 Microcebus murinus 98.21 0.00e+00 730.00
IUUC-Mdo-062449 Monodelphis domestica 94.63 0.00e+00 691.00
IUUC-Mmu-063151 Mus musculus 94.88 0.00e+00 703.00
IUUC-Mac-065020 Musa acuminata 37.82 7.00e-23 101.00
IUUC-Mpu-066621 Mustela putorius furo 97.95 0.00e+00 731.00
IUUC-Mlu-067336 Myotis lucifugus 98.47 0.00e+00 713.00
IUUC-Nfi-068530 Neosartorya fischeri 38.76 3.00e-23 103.00
IUUC-Ncr-068785 Neurospora crassa 36.03 2.00e-24 107.00
IUUC-Nle-069972 Nomascus leucogenys 98.47 0.00e+00 703.00
IUUC-Opr-071150 Ochotona princeps 69.05 8.00e-124 436.00
IUUC-Ont-071366 Oreochromis niloticus 81.59 0.00e+00 634.00
IUUC-Oan-073290 Ornithorhynchus anatinus 94.35 2.00e-105 374.00
IUUC-Ocu-074351 Oryctolagus cuniculus 98.47 0.00e+00 733.00
IUUC-Oba-075338 Oryza barthii 35.71 3.00e-11 62.40
IUUC-Obr-076135 Oryza brachyantha 26.59 1.00e-28 120.00
IUUC-Ogl-077182 Oryza glaberrima 37.38 5.00e-17 82.00
IUUC-Ogu-078281 Oryza glumaepatula 27.30 2.00e-20 93.20
IUUC-Oin-079068 Oryza indica 37.38 1.00e-16 80.90
IUUC-Olo-080460 Oryza longistaminata 35.80 1.00e-08 52.40
IUUC-Ome-081781 Oryza meridionalis 26.36 9.00e-18 84.70
IUUC-Oni-082517 Oryza nivara 27.00 2.00e-20 93.20
IUUC-Opu-084101 Oryza punctata 37.38 4.00e-17 82.00
IUUC-Oru-084556 Oryza rufipogon 37.38 6.00e-17 81.60
IUUC-Osa-086264 Oryza sativa 37.38 5.00e-17 82.00
IUUC-Ola-087252 Oryzias latipes 93.29 3.00e-69 253.00
IUUC-Olu-087610 Ostreococcus lucimarinus 27.17 5.00e-15 75.10
IUUC-Oga-088304 Otolemur garnettii 97.95 0.00e+00 727.00
IUUC-Oar-089734 Ovis aries 98.21 0.00e+00 753.00
IUUC-Ptr-091476 Pan troglodytes 98.47 0.00e+00 703.00
IUUC-Pan-092341 Papio anubis 98.47 0.00e+00 703.00
IUUC-Psi-093470 Pelodiscus sinensis 92.99 0.00e+00 672.00
IUUC-Pma-094143 Petromyzon marinus 64.36 2.00e-132 465.00
IUUC-Pno-095069 Phaeosphaeria nodorum 31.93 5.00e-14 72.40
IUUC-Ppa-095933 Physcomitrella patens 30.65 1.00e-38 153.00
IUUC-Pfo-096321 Poecilia formosa 82.35 2.00e-175 608.00
IUUC-Pab-098527 Pongo abelii 98.30 1.00e-180 625.00
IUUC-Pop-099323 Populus trichocarpa 27.65 1.00e-36 147.00
IUUC-Pca-101044 Procavia capensis 81.07 1.00e-159 555.00
IUUC-Ppe-101458 Prunus persica 40.83 9.00e-27 114.00
IUUC-Pva-103014 Pteropus vampyrus 87.98 2.00e-173 601.00
IUUC-Pgr-103615 Puccinia graminis 36.09 4.00e-20 92.80
IUUC-Ptt-103826 Puccinia triticina 40.20 2.00e-16 80.10
IUUC-Pte-104171 Pyrenophora teres 35.29 3.00e-21 96.70
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 2.00e-10 60.50
IUUC-Rno-105957 Rattus norvegicus 93.86 0.00e+00 696.00
IUUC-Sce-106262 Saccharomyces cerevisiae 27.14 3.00e-10 59.30
IUUC-Sha-107607 Sarcophilus harrisii 95.70 8.00e-175 605.00
IUUC-Spo-108175 Schizosaccharomyces pombe 30.56 1.10e-02 34.70
IUUC-Ssl-108672 Sclerotinia sclerotiorum 35.29 4.00e-25 109.00
IUUC-Smo-108973 Selaginella moellendorffii 38.60 1.00e-20 94.00
IUUC-Sly-111373 Solanum lycopersicum 36.51 1.00e-23 103.00
IUUC-Stu-112844 Solanum tuberosum 35.71 8.00e-23 101.00
IUUC-Sar-113653 Sorex araneus 82.26 7.00e-177 612.00
IUUC-Sbi-114390 Sorghum bicolor 26.61 3.00e-29 122.00
IUUC-Sre-115200 Sporisorium reilianum 37.50 4.00e-24 106.00
IUUC-Ssc-115888 Sus scrofa 99.56 1.00e-113 401.00
IUUC-Tgu-117506 Taeniopygia guttata 89.34 0.00e+00 694.00
IUUC-Tru-118063 Takifugu rubripes 78.83 4.00e-170 590.00
IUUC-Tsy-118851 Tarsius syrichta 75.00 2.00e-144 504.00
IUUC-Tni-120010 Tetraodon nigroviridis 77.83 1.00e-168 585.00
IUUC-Tca-121182 Theobroma cacao 38.89 4.00e-22 99.00
IUUC-Tre-122040 Trichoderma reesei 36.15 1.00e-21 97.80
IUUC-Tvi-122660 Trichoderma virens 39.71 2.00e-25 110.00
IUUC-Tae-124561 Triticum aestivum 27.35 1.00e-26 114.00
IUUC-Tur-126651 Triticum urartu 39.13 2.00e-20 93.20
IUUC-Tme-127184 Tuber melanosporum 47.32 2.00e-25 110.00
IUUC-Tbe-127894 Tupaia belangeri 83.00 4.00e-90 324.00
IUUC-Ttr-128264 Tursiops truncatus 89.00 0.00e+00 704.00
IUUC-Uma-129407 Ustilago maydis 36.18 1.00e-24 108.00
IUUC-Vda-130002 Verticillium dahliae 29.73 1.00e-15 77.80
IUUC-Vpa-130156 Vicugna pacos 98.00 5.00e-97 347.00
IUUC-Vvi-131479 Vitis vinifera 41.23 2.00e-23 103.00
IUUC-Xtr-132332 Xenopus tropicalis 81.68 1.00e-63 234.00
IUUC-Xma-133186 Xiphophorus maculatus 82.10 7.00e-179 619.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 6.00e-13 68.20
IUUC-Zma-135391 Zea mays 35.29 1.00e-19 90.90
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved