• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Cne-026889
Ensembl Protein ID AAW41320
UniProt Accession P0CO54; Q55YQ9; Q5KN30; ATG8_CRYNJ
Genbank Protein ID AAW41320.1
Protein Name Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier ATG8
Genbank Nucleotide ID AE017341
Gene Name ATG8; CNA07930
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
CNA07930 AAW41320 AAW41320
Status Unreviewed
Classification
Family E-Value Score Start End
ULD/UBL/ATG8 2.10e-48 161.2 14 117
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   ULD/UBL/ATG8

   S: 1    krkeevekirdkfpdkiPvivekakkekipeldkkkylvPsdltvgqlvkiirkrlqlraedalfllvnnslvsvsatlaeiyeeekdedgflyvayasee 101
    krk+e+e+ir+k++d+iPvi+eka+k++ip++dkkkylvP+dltvgq+v++irkr++l +e+a+f++v++ l++++a +++iy+e+kdedgflyv yase+
   Q: 14 KRKAEAERIRQKYQDRIPVICEKAEKSDIPTIDKKKYLVPADLTVGQFVYVIRKRIKLAPEKAIFIFVDDILPPTAALMSSIYDEHKDEDGFLYVLYASEN 114
    699************************************************************************************************** PP
   S: 102 tfG 104
    tfG
   Q: 115 TFG 117
    **9 PP
   

Organism Cryptococcus neoformans
Functional Description
(View)

Functional Description



     Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Protein Sequence
(Fasta)
MVRSKFKDEH PFDKRKAEAE RIRQKYQDRI PVICEKAEKS DIPTIDKKKY LVPADLTVGQ 60
FVYVIRKRIK LAPEKAIFIF VDDILPPTAA LMSSIYDEHK DEDGFLYVLY ASENTFGDLE 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Cne-026889|ULD,ATG8|Cryptococcus neoformans
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTCCTTCAAC TCCTTTTACT ATTACTGCTG TCTAACTACT CCTTATTTAC TCGGCGTGAG 60
TTCCATGATA CTCCGTGGAT GGCAAAGGCG TGCTGACTTC ACCACCAGCA ACAGCAACAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Cne-026889|ULD,ATG8|Cryptococcus neoformans
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0072--Autophagy
KW-0181--Complete proteome
KW-0968--Cytoplasmic vesicle
KW-0449--Lipoprotein
KW-0472--Membrane
KW-0653--Protein transport
KW-1185--Reference proteome
KW-0813--Transport
KW-0833--Ubl conjugation pathway
KW-0926--Vacuole

Interpro

IPR004241--Atg8-like
IPR029071--Ubiquitin-rel_dom

Pfam

PF02991--Atg8

Gene Ontology

GO:0000421--C:autophagosome membrane
GO:0031410--C:cytoplasmic vesicle
GO:0006914--P:autophagy
GO:0015031--P:protein transport

KEGG cne:CNA07930
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000059 Aegilops tauschii 73.50 8.00e-51 189.00
IUUC-Aml-001323 Ailuropoda melanoleuca 58.04 6.00e-38 147.00
IUUC-Atr-002791 Amborella trichopoda 77.31 3.00e-52 194.00
IUUC-Apl-003994 Anas platyrhynchos 54.31 4.00e-37 144.00
IUUC-Aca-005288 Anolis carolinensis 56.25 2.00e-35 138.00
IUUC-Aly-005554 Arabidopsis lyrata 79.49 3.00e-45 171.00
IUUC-Ath-006958 Arabidopsis thaliana 78.63 1.00e-44 169.00
IUUC-Ago-007898 Ashbya gossypii 72.03 2.00e-49 185.00
IUUC-Acl-008314 Aspergillus clavatus 88.14 3.00e-59 217.00
IUUC-Afl-008708 Aspergillus flavus 88.98 7.00e-60 219.00
IUUC-Afu-009097 Aspergillus fumigatus 88.14 3.00e-59 217.00
IUUC-Ani-009196 Aspergillus nidulans 87.29 2.00e-58 215.00
IUUC-Ang-009530 Aspergillus niger 88.14 3.00e-59 217.00
IUUC-Aor-009909 Aspergillus oryzae 88.98 7.00e-60 219.00
IUUC-Ate-010358 Aspergillus terreus 88.14 3.00e-59 217.00
IUUC-Ame-010914 Astyanax mexicanus 55.56 5.00e-38 147.00
IUUC-Bgr-012248 Blumeria graminis 86.44 6.00e-58 213.00
IUUC-Bta-012805 Bos taurus 58.04 6.00e-38 147.00
IUUC-Bci-013959 Botrytis cinerea 87.18 8.00e-59 216.00
IUUC-Bdi-014390 Brachypodium distachyon 78.15 7.00e-52 193.00
IUUC-Bol-016488 Brassica oleracea 78.63 2.00e-52 195.00
IUUC-Bra-016921 Brassica rapa 78.63 4.00e-52 194.00
IUUC-Cel-018200 Caenorhabditis elegans 53.45 2.00e-35 138.00
IUUC-Cja-019369 Callithrix jacchus 58.04 6.00e-38 147.00
IUUC-Cfa-020603 Canis familiaris 58.04 6.00e-38 147.00
IUUC-Cpo-022522 Cavia porcellus 54.31 4.00e-37 144.00
IUUC-Cre-022866 Chlamydomonas reinhardtii 75.59 9.00e-46 173.00
IUUC-Csa-024117 Chlorocebus sabaeus 58.04 6.00e-38 147.00
IUUC-Cho-025008 Choloepus hoffmanni 50.86 2.00e-34 135.00
IUUC-Cin-025297 Ciona intestinalis 56.03 1.00e-38 149.00
IUUC-Csv-026146 Ciona savignyi 39.32 3.00e-22 95.10
IUUC-Cgl-026691 Colletotrichum gloeosporioides 63.80 8.00e-53 197.00
IUUC-Cme-027158 Cyanidioschyzon merolae 31.25 1.80e-01 27.30
IUUC-Dre-027910 Danio rerio 57.89 2.00e-38 148.00
IUUC-Dno-029218 Dasypus novemcinctus 58.18 1.00e-36 144.00
IUUC-Dor-030245 Dipodomys ordii 58.04 6.00e-38 147.00
IUUC-Dse-031428 Dothistroma septosporum 88.03 5.00e-59 217.00
IUUC-Dme-031813 Drosophila melanogaster 57.76 3.00e-39 151.00
IUUC-Ete-032671 Echinops telfairi 58.04 7.00e-38 146.00
IUUC-Eca-033464 Equus caballus 54.31 4.00e-37 144.00
IUUC-Eeu-035131 Erinaceus europaeus 54.65 9.00e-26 105.00
IUUC-Fca-036493 Felis catus 58.04 8.00e-38 147.00
IUUC-Fal-037143 Ficedula albicollis 52.07 1.00e-37 145.00
IUUC-Fox-037846 Fusarium oxysporum 88.89 1.00e-59 218.00
IUUC-Fso-038134 Fusarium solani 88.89 2.00e-59 218.00
IUUC-Gmo-039671 Gadus morhua 53.72 3.00e-38 148.00
IUUC-Ggr-039770 Gaeumannomyces graminis 84.55 2.00e-58 215.00
IUUC-Gga-040257 Gallus gallus 58.93 3.00e-38 147.00
IUUC-Gac-042507 Gasterosteus aculeatus 52.85 3.00e-38 148.00
IUUC-Gma-043726 Glycine max 77.87 2.00e-46 175.00
IUUC-Ggo-044860 Gorilla gorilla 58.04 8.00e-38 146.00
IUUC-Hsa-045905 Homo sapiens 58.04 6.00e-38 147.00
IUUC-Hvu-047588 Hordeum vulgare 76.03 3.00e-52 194.00
IUUC-Itr-048405 Ictidomys tridecemlineatus 58.04 6.00e-38 147.00
IUUC-Kpa-049124 Komagataella pastoris 81.36 5.00e-55 203.00
IUUC-Lch-049798 Latimeria chalumnae 52.59 2.00e-37 145.00
IUUC-Lpe-051292 Leersia perrieri 78.63 3.00e-52 194.00
IUUC-Loc-052290 Lepisosteus oculatus 56.03 7.00e-38 147.00
IUUC-Laf-054203 Loxodonta africana 58.04 6.00e-38 147.00
IUUC-Mcc-055307 Macaca mulatta 58.04 6.00e-38 147.00
IUUC-Meu-056010 Macropus eugenii 54.31 4.00e-37 144.00
IUUC-Mor-057276 Magnaporthe oryzae 88.14 1.00e-58 215.00
IUUC-Mpo-057469 Magnaporthe poae 83.74 1.00e-57 213.00
IUUC-Mtr-058417 Medicago truncatula 78.99 7.00e-46 173.00
IUUC-Mla-059098 Melampsora laricipopulina 87.93 8.00e-59 216.00
IUUC-Mga-060108 Meleagris gallopavo 53.39 2.00e-37 145.00
IUUC-Mvi-060496 Microbotryum violaceum 88.89 3.00e-58 214.00
IUUC-Mmr-061776 Microcebus murinus 58.04 6.00e-38 147.00
IUUC-Mdo-062279 Monodelphis domestica 53.85 4.00e-37 144.00
IUUC-Mmu-064157 Mus musculus 58.04 6.00e-38 147.00
IUUC-Mac-064522 Musa acuminata 75.63 2.00e-45 172.00
IUUC-Mpu-066028 Mustela putorius furo 58.04 1.00e-37 146.00
IUUC-Mlu-067166 Myotis lucifugus 58.04 6.00e-38 147.00
IUUC-Nfi-068367 Neosartorya fischeri 88.14 3.00e-59 217.00
IUUC-Ncr-068894 Neurospora crassa 88.24 4.00e-60 220.00
IUUC-Nle-069220 Nomascus leucogenys 58.04 6.00e-38 147.00
IUUC-Opr-070777 Ochotona princeps 58.04 6.00e-38 147.00
IUUC-Ont-072343 Oreochromis niloticus 54.31 2.00e-35 138.00
IUUC-Oan-073485 Ornithorhynchus anatinus 56.25 5.00e-33 130.00
IUUC-Ocu-074148 Oryctolagus cuniculus 58.04 6.00e-38 147.00
IUUC-Oba-075926 Oryza barthii 77.78 2.00e-51 192.00
IUUC-Obr-076830 Oryza brachyantha 77.78 3.00e-52 194.00
IUUC-Ogl-077457 Oryza glaberrima 77.78 2.00e-51 192.00
IUUC-Ogu-078078 Oryza glumaepatula 77.78 2.00e-51 192.00
IUUC-Oin-079771 Oryza indica 77.78 2.00e-51 192.00
IUUC-Olo-080412 Oryza longistaminata 77.78 2.00e-51 192.00
IUUC-Ome-081791 Oryza meridionalis 77.78 2.00e-51 192.00
IUUC-Oni-082774 Oryza nivara 77.78 2.00e-51 192.00
IUUC-Opu-083501 Oryza punctata 77.31 2.00e-52 194.00
IUUC-Oru-084425 Oryza rufipogon 75.63 5.00e-51 190.00
IUUC-Osa-085439 Oryza sativa 77.78 2.00e-51 192.00
IUUC-Ola-086310 Oryzias latipes 55.17 8.00e-36 139.00
IUUC-Olu-087892 Ostreococcus lucimarinus 79.46 3.00e-52 194.00
IUUC-Oga-088312 Otolemur garnettii 58.04 6.00e-38 147.00
IUUC-Oar-089989 Ovis aries 58.04 6.00e-38 147.00
IUUC-Ptr-091108 Pan troglodytes 58.04 6.00e-38 147.00
IUUC-Pan-092269 Papio anubis 54.31 2.00e-35 138.00
IUUC-Psi-093055 Pelodiscus sinensis 54.31 4.00e-37 144.00
IUUC-Pma-094337 Petromyzon marinus 55.36 9.00e-37 143.00
IUUC-Pno-095035 Phaeosphaeria nodorum 88.03 4.00e-59 217.00
IUUC-Ppa-095786 Physcomitrella patens 80.34 9.00e-53 196.00
IUUC-Pfo-096380 Poecilia formosa 57.14 4.00e-36 140.00
IUUC-Pab-097660 Pongo abelii 58.04 6.00e-38 147.00
IUUC-Pop-100069 Populus trichocarpa 79.49 9.00e-46 172.00
IUUC-Pca-100230 Procavia capensis 58.04 6.00e-38 147.00
IUUC-Ppe-101670 Prunus persica 76.92 3.00e-45 171.00
IUUC-Pva-103103 Pteropus vampyrus 54.31 4.00e-37 144.00
IUUC-Pgr-103531 Puccinia graminis 18.45 1.20e-01 26.20
IUUC-Pte-104230 Pyrenophora teres 88.03 3.00e-59 217.00
IUUC-Rno-105497 Rattus norvegicus 58.04 6.00e-38 147.00
IUUC-Sce-106150 Saccharomyces cerevisiae 78.45 6.00e-52 193.00
IUUC-Sha-106656 Sarcophilus harrisii 58.04 6.00e-38 147.00
IUUC-Sja-107857 Schizosaccharomyces japonicus 80.17 1.00e-53 199.00
IUUC-Spo-108156 Schizosaccharomyces pombe 76.27 3.00e-45 171.00
IUUC-Ssl-108578 Sclerotinia sclerotiorum 87.18 9.00e-59 216.00
IUUC-Smo-109082 Selaginella moellendorffii 79.13 8.00e-52 193.00
IUUC-Sit-109732 Setaria italica 76.92 9.00e-51 189.00
IUUC-Sly-111700 Solanum lycopersicum 78.81 2.00e-52 194.00
IUUC-Stu-112612 Solanum tuberosum 79.17 6.00e-54 200.00
IUUC-Sar-113670 Sorex araneus 52.68 7.00e-34 133.00
IUUC-Sbi-114346 Sorghum bicolor 77.78 2.00e-51 191.00
IUUC-Sre-114964 Sporisorium reilianum 84.48 4.00e-56 207.00
IUUC-Ssc-116182 Sus scrofa 58.04 6.00e-38 147.00
IUUC-Tgu-116669 Taeniopygia guttata 54.31 5.00e-37 144.00
IUUC-Tru-118632 Takifugu rubripes 55.56 5.00e-38 147.00
IUUC-Tsy-118919 Tarsius syrichta 54.31 4.00e-37 144.00
IUUC-Tni-120706 Tetraodon nigroviridis 55.17 8.00e-36 140.00
IUUC-Tca-121335 Theobroma cacao 76.07 6.00e-46 174.00
IUUC-Tre-122077 Trichoderma reesei 88.79 5.00e-59 217.00
IUUC-Tvi-122400 Trichoderma virens 88.79 5.00e-59 217.00
IUUC-Tae-124455 Triticum aestivum 76.47 4.00e-51 191.00
IUUC-Tur-126158 Triticum urartu 72.03 6.00e-50 187.00
IUUC-Tme-126955 Tuber melanosporum 87.18 2.00e-57 212.00
IUUC-Tbe-127765 Tupaia belangeri 59.30 1.00e-27 112.00
IUUC-Ttr-128712 Tursiops truncatus 54.31 4.00e-37 144.00
IUUC-Uma-129435 Ustilago maydis 83.90 2.00e-56 208.00
IUUC-Vda-129807 Verticillium dahliae 88.24 5.00e-60 220.00
IUUC-Vpa-130804 Vicugna pacos 54.31 3.00e-35 138.00
IUUC-Vvi-130830 Vitis vinifera 76.47 1.00e-45 172.00
IUUC-Xtr-132183 Xenopus tropicalis 54.31 4.00e-37 144.00
IUUC-Xma-133400 Xiphophorus maculatus 54.17 6.00e-38 147.00
IUUC-Yli-134327 Yarrowia lipolytica 85.37 4.00e-53 197.00
IUUC-Zma-135270 Zea mays 78.15 3.00e-52 194.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved