• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Yli-134327
Ensembl Protein ID CAG79047
UniProt Accession Q6C794; ATG8_YARLI
Genbank Protein ID CAG79047.2
Protein Name Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier ATG8
Genbank Nucleotide ID CR382131
Gene Name ATG8; YALI0E02662g
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
YALI0_E02662g CAG79047 CAG79047
Status Unreviewed
Classification
Family E-Value Score Start End
ULD/UBL/ATG8 4.10e-48 160.3 13 116
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   ULD/UBL/ATG8

   S: 1    krkeevekirdkfpdkiPvivekakkekipeldkkkylvPsdltvgqlvkiirkrlqlraedalfllvnnslvsvsatlaeiyeeekdedgflyvayasee 101
    kr++e+e+ir+k++d++Pvi+ek +k++ip++dkkkylvP+dltvgq+v++irkr++l +e a+f++v+++l++++a +++iyee+kdedgflyv+y++e+
   Q: 13 KRRAEAERIRKKYDDRVPVICEKVEKSDIPVIDKKKYLVPADLTVGQFVYVIRKRIKLSSERAIFIFVDDVLPPTAALMSSIYEEHKDEDGFLYVTYSGEN 113
    699************************************************************************************************** PP
   S: 102 tfG 104
    tfG
   Q: 114 TFG 116
    **9 PP
   

Organism Yarrowia lipolytica
Functional Description
(View)

Functional Description



     Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Ubiquitin-like modifier involved in autophagosomes formation. With ATG4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.
Protein Sequence
(Fasta)
MRSKFKDEHP FEKRRAEAER IRKKYDDRVP VICEKVEKSD IPVIDKKKYL VPADLTVGQF 60
VYVIRKRIKL SSERAIFIFV DDVLPPTAAL MSSIYEEHKD EDGFLYVTYS GENTFGDLEQ 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Yli-134327|ULD,ATG8|Yarrowia lipolytica
Please wait for a moment...
Nucleotide Sequence
(Fasta)
AGTGAGTATC GAGGGACATG GAATGATGGC CCGTGGCGTC CGACGGTGAC GGCTACTCTA 60
ACCTGTCAAT TGTTGAGGCC GTCTGGGCTT GCCTCCGCTT GTGCCTGATG GCCAGATGAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Yli-134327|ULD,ATG8|Yarrowia lipolytica
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0072--Autophagy
KW-0181--Complete proteome
KW-0968--Cytoplasmic vesicle
KW-0449--Lipoprotein
KW-0472--Membrane
KW-0653--Protein transport
KW-1185--Reference proteome
KW-0813--Transport
KW-0833--Ubl conjugation pathway
KW-0926--Vacuole

Interpro

IPR004241--Atg8-like
IPR029071--Ubiquitin-rel_dom

Pfam

PF02991--Atg8

Gene Ontology

GO:0000421--C:autophagosome membrane
GO:0031410--C:cytoplasmic vesicle
GO:0006914--P:autophagy
GO:0015031--P:protein transport

KEGG yli:YALI0E02662g
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000059 Aegilops tauschii 75.65 1.00e-50 189.00
IUUC-Aml-001629 Ailuropoda melanoleuca 60.34 1.00e-38 149.00
IUUC-Atr-002791 Amborella trichopoda 81.20 1.00e-53 199.00
IUUC-Apl-003994 Anas platyrhynchos 56.90 2.00e-37 145.00
IUUC-Aca-005288 Anolis carolinensis 60.34 9.00e-39 149.00
IUUC-Aly-005554 Arabidopsis lyrata 83.48 5.00e-46 173.00
IUUC-Ath-006958 Arabidopsis thaliana 82.61 2.00e-45 171.00
IUUC-Ago-007898 Ashbya gossypii 72.88 3.00e-50 187.00
IUUC-Acl-008314 Aspergillus clavatus 90.68 2.00e-60 221.00
IUUC-Afl-008708 Aspergillus flavus 91.53 5.00e-61 223.00
IUUC-Afu-009097 Aspergillus fumigatus 90.68 2.00e-60 221.00
IUUC-Ani-009196 Aspergillus nidulans 90.68 3.00e-60 221.00
IUUC-Ang-009530 Aspergillus niger 90.68 2.00e-60 221.00
IUUC-Aor-009909 Aspergillus oryzae 91.53 5.00e-61 223.00
IUUC-Ate-010358 Aspergillus terreus 90.68 2.00e-60 221.00
IUUC-Ame-010751 Astyanax mexicanus 60.34 8.00e-39 149.00
IUUC-Bgr-012248 Blumeria graminis 88.98 4.00e-59 217.00
IUUC-Bta-012520 Bos taurus 60.34 2.00e-38 148.00
IUUC-Bci-013959 Botrytis cinerea 88.89 7.00e-60 219.00
IUUC-Bdi-014390 Brachypodium distachyon 81.20 5.00e-53 197.00
IUUC-Bol-016488 Brassica oleracea 82.61 2.00e-53 198.00
IUUC-Bra-017452 Brassica rapa 81.74 2.00e-52 195.00
IUUC-Cel-018200 Caenorhabditis elegans 55.17 1.00e-35 139.00
IUUC-Cja-019273 Callithrix jacchus 59.48 2.00e-38 148.00
IUUC-Cfa-020373 Canis familiaris 60.34 1.00e-38 149.00
IUUC-Cpo-021831 Cavia porcellus 60.34 1.00e-38 149.00
IUUC-Cre-022866 Chlamydomonas reinhardtii 78.99 4.00e-46 174.00
IUUC-Csa-024201 Chlorocebus sabaeus 60.34 1.00e-38 149.00
IUUC-Cho-025008 Choloepus hoffmanni 53.45 7.00e-35 136.00
IUUC-Cin-025297 Ciona intestinalis 58.62 2.00e-38 148.00
IUUC-Csv-026146 Ciona savignyi 39.32 8.00e-23 97.10
IUUC-Cgl-026691 Colletotrichum gloeosporioides 65.64 5.00e-54 201.00
IUUC-Cne-026889 Cryptococcus neoformans 85.37 1.00e-60 222.00
IUUC-Dre-028371 Danio rerio 59.48 5.00e-38 147.00
IUUC-Dno-029331 Dasypus novemcinctus 60.34 1.00e-38 149.00
IUUC-Dor-030453 Dipodomys ordii 60.34 1.00e-38 149.00
IUUC-Dse-031428 Dothistroma septosporum 90.60 4.00e-60 220.00
IUUC-Dme-031813 Drosophila melanogaster 61.21 8.00e-40 153.00
IUUC-Ete-032671 Echinops telfairi 61.21 7.00e-40 153.00
IUUC-Eca-034113 Equus caballus 60.34 2.00e-38 149.00
IUUC-Eeu-035131 Erinaceus europaeus 56.98 3.00e-26 107.00
IUUC-Fca-036385 Felis catus 60.34 1.00e-38 149.00
IUUC-Fal-036896 Ficedula albicollis 60.34 2.00e-38 149.00
IUUC-Fox-037846 Fusarium oxysporum 91.45 9.00e-61 222.00
IUUC-Fso-038134 Fusarium solani 91.45 1.00e-60 222.00
IUUC-Gmo-039289 Gadus morhua 59.48 3.00e-38 147.00
IUUC-Ggr-039770 Gaeumannomyces graminis 88.98 2.00e-59 218.00
IUUC-Gga-040257 Gallus gallus 60.34 8.00e-39 149.00
IUUC-Gac-041604 Gasterosteus aculeatus 61.21 9.00e-40 153.00
IUUC-Gma-043726 Glycine max 80.83 3.00e-46 174.00
IUUC-Ggo-044429 Gorilla gorilla 60.34 1.00e-38 149.00
IUUC-Hsa-046764 Homo sapiens 60.34 1.00e-38 149.00
IUUC-Hvu-047588 Hordeum vulgare 78.99 3.00e-53 197.00
IUUC-Itr-048405 Ictidomys tridecemlineatus 61.21 9.00e-40 152.00
IUUC-Kpa-049124 Komagataella pastoris 83.05 2.00e-56 208.00
IUUC-Lch-049542 Latimeria chalumnae 59.48 1.00e-38 149.00
IUUC-Lpe-051292 Leersia perrieri 80.87 4.00e-52 194.00
IUUC-Loc-052290 Lepisosteus oculatus 61.21 7.00e-40 154.00
IUUC-Laf-054203 Loxodonta africana 61.21 9.00e-40 152.00
IUUC-Mcc-055307 Macaca mulatta 61.21 9.00e-40 152.00
IUUC-Meu-056515 Macropus eugenii 60.34 1.00e-38 149.00
IUUC-Mor-057276 Magnaporthe oryzae 89.83 1.00e-59 219.00
IUUC-Mpo-057469 Magnaporthe poae 88.98 6.00e-59 216.00
IUUC-Mtr-058417 Medicago truncatula 82.05 8.00e-46 173.00
IUUC-Mla-059098 Melampsora laricipopulina 87.07 2.00e-58 215.00
IUUC-Mga-060108 Meleagris gallopavo 55.93 1.00e-37 146.00
IUUC-Mvi-060496 Microbotryum violaceum 87.83 3.00e-57 211.00
IUUC-Mmr-061776 Microcebus murinus 61.21 9.00e-40 152.00
IUUC-Mdo-061915 Monodelphis domestica 60.34 1.00e-38 149.00
IUUC-Mmu-064152 Mus musculus 60.34 1.00e-38 149.00
IUUC-Mac-064739 Musa acuminata 77.78 8.00e-46 172.00
IUUC-Mpu-066760 Mustela putorius furo 60.34 1.00e-38 149.00
IUUC-Mlu-068211 Myotis lucifugus 60.34 1.00e-38 149.00
IUUC-Nfi-068367 Neosartorya fischeri 90.68 2.00e-60 221.00
IUUC-Ncr-068894 Neurospora crassa 90.76 3.00e-61 224.00
IUUC-Nle-069755 Nomascus leucogenys 60.34 1.00e-38 149.00
IUUC-Opr-070777 Ochotona princeps 61.21 1.00e-39 152.00
IUUC-Ont-072343 Oreochromis niloticus 60.34 1.00e-38 149.00
IUUC-Oan-073485 Ornithorhynchus anatinus 62.86 1.00e-35 139.00
IUUC-Ocu-073861 Oryctolagus cuniculus 60.34 1.00e-38 149.00
IUUC-Oba-075926 Oryza barthii 80.87 2.00e-52 195.00
IUUC-Obr-076374 Oryza brachyantha 80.87 2.00e-52 195.00
IUUC-Ogl-077457 Oryza glaberrima 80.87 2.00e-52 195.00
IUUC-Ogu-078078 Oryza glumaepatula 80.87 2.00e-52 195.00
IUUC-Oin-079771 Oryza indica 80.87 2.00e-52 195.00
IUUC-Olo-080412 Oryza longistaminata 80.87 2.00e-52 195.00
IUUC-Ome-081791 Oryza meridionalis 80.87 2.00e-52 195.00
IUUC-Oni-082774 Oryza nivara 80.87 2.00e-52 195.00
IUUC-Opu-083486 Oryza punctata 80.87 6.00e-52 195.00
IUUC-Oru-084197 Oryza rufipogon 75.65 9.00e-51 189.00
IUUC-Osa-085439 Oryza sativa 80.87 2.00e-52 195.00
IUUC-Ola-086310 Oryzias latipes 59.48 5.00e-38 147.00
IUUC-Olu-087892 Ostreococcus lucimarinus 82.14 2.00e-53 198.00
IUUC-Oga-088483 Otolemur garnettii 60.34 1.00e-38 149.00
IUUC-Oar-089989 Ovis aries 61.21 9.00e-40 152.00
IUUC-Ptr-091560 Pan troglodytes 60.34 1.00e-38 149.00
IUUC-Pan-092269 Papio anubis 60.34 1.00e-38 149.00
IUUC-Psi-093055 Pelodiscus sinensis 56.90 2.00e-37 145.00
IUUC-Pma-094337 Petromyzon marinus 60.34 2.00e-40 155.00
IUUC-Pno-095035 Phaeosphaeria nodorum 90.60 2.00e-60 221.00
IUUC-Ppa-095786 Physcomitrella patens 83.48 2.00e-53 198.00
IUUC-Pfo-096380 Poecilia formosa 59.48 2.00e-38 148.00
IUUC-Pab-098563 Pongo abelii 60.34 1.00e-38 149.00
IUUC-Pop-100069 Populus trichocarpa 82.61 1.00e-45 172.00
IUUC-Pca-100230 Procavia capensis 61.21 9.00e-40 152.00
IUUC-Ppe-101670 Prunus persica 79.13 3.00e-46 174.00
IUUC-Pva-103103 Pteropus vampyrus 56.90 2.00e-37 145.00
IUUC-Pte-104230 Pyrenophora teres 90.60 2.00e-60 221.00
IUUC-Rno-105111 Rattus norvegicus 60.34 1.00e-38 149.00
IUUC-Sce-106150 Saccharomyces cerevisiae 78.45 3.00e-52 194.00
IUUC-Sha-106656 Sarcophilus harrisii 61.21 9.00e-40 152.00
IUUC-Sja-107857 Schizosaccharomyces japonicus 81.90 3.00e-54 201.00
IUUC-Spo-108156 Schizosaccharomyces pombe 78.81 2.00e-46 175.00
IUUC-Ssl-108578 Sclerotinia sclerotiorum 88.89 1.00e-59 219.00
IUUC-Smo-109082 Selaginella moellendorffii 80.00 2.00e-52 195.00
IUUC-Sit-109732 Setaria italica 80.00 6.00e-52 193.00
IUUC-Sly-111488 Solanum lycopersicum 78.63 6.00e-47 176.00
IUUC-Stu-112612 Solanum tuberosum 82.20 3.00e-54 201.00
IUUC-Sar-113670 Sorex araneus 56.03 3.00e-35 138.00
IUUC-Sbi-114346 Sorghum bicolor 80.87 2.00e-52 195.00
IUUC-Sre-114964 Sporisorium reilianum 82.76 2.00e-55 204.00
IUUC-Ssc-115828 Sus scrofa 60.34 1.00e-38 149.00
IUUC-Tgu-117195 Taeniopygia guttata 60.34 1.00e-38 149.00
IUUC-Tru-118632 Takifugu rubripes 59.17 6.00e-40 154.00
IUUC-Tsy-118919 Tarsius syrichta 56.90 2.00e-37 145.00
IUUC-Tni-120706 Tetraodon nigroviridis 59.48 5.00e-38 147.00
IUUC-Tca-121837 Theobroma cacao 83.48 3.00e-45 171.00
IUUC-Tre-122077 Trichoderma reesei 91.38 4.00e-60 220.00
IUUC-Tvi-122400 Trichoderma virens 91.38 4.00e-60 220.00
IUUC-Tae-124455 Triticum aestivum 79.49 3.00e-52 194.00
IUUC-Tur-126158 Triticum urartu 74.78 9.00e-50 186.00
IUUC-Tme-126955 Tuber melanosporum 90.52 1.00e-58 216.00
IUUC-Tbe-127765 Tupaia belangeri 63.95 1.00e-29 118.00
IUUC-Ttr-128205 Tursiops truncatus 60.34 1.00e-38 149.00
IUUC-Uma-129435 Ustilago maydis 82.20 7.00e-56 206.00
IUUC-Vda-129807 Verticillium dahliae 90.76 3.00e-61 224.00
IUUC-Vpa-130804 Vicugna pacos 59.48 3.00e-38 147.00
IUUC-Vvi-130830 Vitis vinifera 80.34 8.00e-47 176.00
IUUC-Xtr-132685 Xenopus tropicalis 60.34 8.00e-39 150.00
IUUC-Xma-133675 Xiphophorus maculatus 59.48 2.00e-38 148.00
IUUC-Zma-135270 Zea mays 81.20 3.00e-53 197.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved