• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • Mentha
  • PTM
    • dbPAF
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Laf-054337
UUCD1 version UUC-LoA-00251
Ensembl Protein ID ENSLAFP00000005889.4
UniProt Accession G3SZA5; G3SZA5_LOXAF
Protein Name Uncharacterized protein
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSLAFG00000007009.4 ENSLAFT00000007011.4 ENSLAFP00000005889.4
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 1.20e-17 63.9 13 47
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGn +++g+CSkC+ree++r+r
   Q: 13 DQSELLCKKGCGYYGNSAWQGFCSKCWREEYHRAR 47
    79*******************************86 PP
   

Organism Loxodonta africana
Protein Sequence
(Fasta)
MSLKSERRGI HVDQSELLCK KGCGYYGNSA WQGFCSKCWR EEYHRARQKQ IQEDWELAER 60
LQREEEEAFA SSQSNQGAQS LTFSKFEEKK TNEKTRKVTT VKKFFSASSR VGSKKEIPEV 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Laf-054337|UBD,ZnF_A20|Loxodonta africana
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGAGCCTGA AGTCTGAACG CCGAGGAATT CACGTGGATC AGTCGGAGCT CCTATGCAAG 60
AAAGGATGTG GTTACTATGG CAACTCTGCG TGGCAGGGCT TCTGCTCCAA GTGCTGGAGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Laf-054337|UBD,ZnF_A20|Loxodonta africana
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0005730--C:nucleolus
GO:0003677--F:DNA binding
GO:0017112--F:Rab guanyl-nucleotide exchange factor activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0006612--P:protein targeting to membrane
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

KEGG lav:100665060
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 29.96 4.00e-19 89.70
IUUC-Aml-001771 Ailuropoda melanoleuca 85.14 0.00e+00 726.00
IUUC-Atr-003154 Amborella trichopoda 35.39 4.00e-22 99.00
IUUC-Apl-004018 Anas platyrhynchos 89.63 0.00e+00 845.00
IUUC-Aca-005227 Anolis carolinensis 22.96 2.00e-08 54.30
IUUC-Aly-006138 Arabidopsis lyrata 34.39 2.00e-24 106.00
IUUC-Ath-006929 Arabidopsis thaliana 31.82 3.00e-25 109.00
IUUC-Ago-007776 Ashbya gossypii 29.17 5.00e-23 102.00
IUUC-Acl-008235 Aspergillus clavatus 30.42 5.00e-28 119.00
IUUC-Afl-008570 Aspergillus flavus 32.00 4.00e-31 129.00
IUUC-Afu-008815 Aspergillus fumigatus 30.42 2.00e-28 120.00
IUUC-Ani-009381 Aspergillus nidulans 30.24 2.00e-29 124.00
IUUC-Ang-009615 Aspergillus niger 30.82 2.00e-31 130.00
IUUC-Aor-010195 Aspergillus oryzae 32.00 2.00e-31 130.00
IUUC-Ate-010514 Aspergillus terreus 31.82 3.00e-30 127.00
IUUC-Ame-011365 Astyanax mexicanus 65.35 0.00e+00 661.00
IUUC-Bgr-012102 Blumeria graminis 29.54 3.00e-29 123.00
IUUC-Bta-013124 Bos taurus 95.11 0.00e+00 867.00
IUUC-Bci-013943 Botrytis cinerea 29.93 3.00e-29 123.00
IUUC-Bdi-014539 Brachypodium distachyon 36.11 1.00e-24 107.00
IUUC-Bol-016580 Brassica oleracea 34.40 6.00e-29 121.00
IUUC-Bra-017843 Brassica rapa 33.94 1.00e-28 120.00
IUUC-Cel-018199 Caenorhabditis elegans 34.10 9.00e-59 221.00
IUUC-Cja-019941 Callithrix jacchus 94.30 0.00e+00 861.00
IUUC-Cfa-020845 Canis familiaris 94.78 0.00e+00 791.00
IUUC-Cpo-022037 Cavia porcellus 94.50 0.00e+00 860.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 31.47 5.00e-20 92.40
IUUC-Csa-023272 Chlorocebus sabaeus 93.89 0.00e+00 860.00
IUUC-Cho-025076 Choloepus hoffmanni 83.91 0.00e+00 734.00
IUUC-Cin-025400 Ciona intestinalis 45.62 1.00e-117 416.00
IUUC-Csv-025941 Ciona savignyi 38.07 1.00e-87 317.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 28.93 8.00e-27 115.00
IUUC-Cne-027057 Cryptococcus neoformans 31.42 2.00e-33 137.00
IUUC-Dre-028484 Danio rerio 70.50 0.00e+00 668.00
IUUC-Dno-028906 Dasypus novemcinctus 94.72 0.00e+00 849.00
IUUC-Dor-030124 Dipodomys ordii 84.69 0.00e+00 739.00
IUUC-Dse-031437 Dothistroma septosporum 28.52 4.00e-26 113.00
IUUC-Dme-031696 Drosophila melanogaster 32.43 8.00e-67 248.00
IUUC-Ete-032573 Echinops telfairi 91.96 0.00e+00 716.00
IUUC-Eca-033711 Equus caballus 95.32 0.00e+00 879.00
IUUC-Eeu-034459 Erinaceus europaeus 72.33 1.00e-76 281.00
IUUC-Fca-035447 Felis catus 92.87 0.00e+00 884.00
IUUC-Fal-036605 Ficedula albicollis 86.04 0.00e+00 783.00
IUUC-Fox-037967 Fusarium oxysporum 26.55 3.00e-18 87.00
IUUC-Fso-038110 Fusarium solani 29.83 1.00e-28 121.00
IUUC-Gmo-038785 Gadus morhua 66.01 0.00e+00 672.00
IUUC-Ggr-039760 Gaeumannomyces graminis 30.55 9.00e-27 115.00
IUUC-Gga-040584 Gallus gallus 90.04 0.00e+00 847.00
IUUC-Gac-042317 Gasterosteus aculeatus 62.85 2.00e-163 568.00
IUUC-Gma-044237 Glycine max 36.87 2.00e-25 110.00
IUUC-Ggo-044498 Gorilla gorilla 80.49 0.00e+00 707.00
IUUC-Hsa-046625 Homo sapiens 94.30 0.00e+00 862.00
IUUC-Hvu-047155 Hordeum vulgare 32.56 4.00e-25 109.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 95.11 0.00e+00 873.00
IUUC-Kpa-049160 Komagataella pastoris 29.39 7.00e-25 108.00
IUUC-Lch-050529 Latimeria chalumnae 78.50 0.00e+00 865.00
IUUC-Lpe-051024 Leersia perrieri 30.54 6.00e-27 115.00
IUUC-Loc-052644 Lepisosteus oculatus 70.02 0.00e+00 665.00
IUUC-Lma-053102 Leptosphaeria maculans 31.62 4.00e-27 116.00
IUUC-Mcc-055659 Macaca mulatta 93.39 5.00e-173 600.00
IUUC-Meu-056084 Macropus eugenii 75.11 2.00e-93 336.00
IUUC-Mor-057255 Magnaporthe oryzae 29.45 2.00e-26 114.00
IUUC-Mpo-057454 Magnaporthe poae 30.55 9.00e-29 121.00
IUUC-Mtr-058098 Medicago truncatula 34.09 2.00e-29 123.00
IUUC-Mla-059068 Melampsora laricipopulina 32.21 1.00e-30 127.00
IUUC-Mga-059624 Meleagris gallopavo 76.78 0.00e+00 837.00
IUUC-Mvi-060282 Microbotryum violaceum 28.53 2.00e-25 111.00
IUUC-Mmr-061142 Microcebus murinus 95.93 0.00e+00 899.00
IUUC-Mdo-062289 Monodelphis domestica 91.45 0.00e+00 892.00
IUUC-Mmu-063961 Mus musculus 94.09 0.00e+00 858.00
IUUC-Mac-065188 Musa acuminata 32.68 1.00e-22 100.00
IUUC-Mpu-066291 Mustela putorius furo 94.51 0.00e+00 860.00
IUUC-Mlu-067431 Myotis lucifugus 90.45 0.00e+00 837.00
IUUC-Nfi-068422 Neosartorya fischeri 30.33 2.00e-29 124.00
IUUC-Ncr-068843 Neurospora crassa 29.54 2.00e-28 120.00
IUUC-Nle-069079 Nomascus leucogenys 94.50 0.00e+00 863.00
IUUC-Opr-070790 Ochotona princeps 94.44 6.00e-57 215.00
IUUC-Ont-071789 Oreochromis niloticus 69.39 2.00e-179 621.00
IUUC-Oan-072946 Ornithorhynchus anatinus 90.06 0.00e+00 828.00
IUUC-Ocu-073816 Oryctolagus cuniculus 95.33 0.00e+00 862.00
IUUC-Oba-075738 Oryza barthii 31.46 4.00e-16 79.30
IUUC-Obr-076355 Oryza brachyantha 36.26 4.00e-26 112.00
IUUC-Ogl-077592 Oryza glaberrima 28.74 1.00e-27 117.00
IUUC-Ogu-078197 Oryza glumaepatula 28.74 2.00e-27 116.00
IUUC-Oin-079629 Oryza indica 28.74 1.00e-27 117.00
IUUC-Olo-080317 Oryza longistaminata 28.74 2.00e-27 115.00
IUUC-Ome-081589 Oryza meridionalis 35.56 9.00e-25 108.00
IUUC-Oni-082700 Oryza nivara 31.46 3.00e-16 79.70
IUUC-Opu-083923 Oryza punctata 33.74 3.00e-21 95.10
IUUC-Oru-084318 Oryza rufipogon 31.46 3.00e-16 79.70
IUUC-Osa-086246 Oryza sativa 37.29 2.00e-06 43.50
IUUC-Ola-086730 Oryzias latipes 56.09 2.00e-149 521.00
IUUC-Olu-087719 Ostreococcus lucimarinus 33.90 2.00e-22 99.80
IUUC-Oga-088992 Otolemur garnettii 82.92 0.00e+00 884.00
IUUC-Oar-089789 Ovis aries 94.73 0.00e+00 859.00
IUUC-Ptr-091636 Pan troglodytes 94.30 0.00e+00 860.00
IUUC-Pan-092911 Papio anubis 94.09 0.00e+00 861.00
IUUC-Psi-093194 Pelodiscus sinensis 77.57 0.00e+00 835.00
IUUC-Pma-094212 Petromyzon marinus 49.09 4.00e-118 418.00
IUUC-Pno-094831 Phaeosphaeria nodorum 30.47 8.00e-28 119.00
IUUC-Ppa-095705 Physcomitrella patens 33.16 5.00e-28 119.00
IUUC-Pfo-096694 Poecilia formosa 65.02 3.00e-179 621.00
IUUC-Pab-097706 Pongo abelii 94.09 0.00e+00 859.00
IUUC-Pop-099891 Populus trichocarpa 31.84 5.00e-25 108.00
IUUC-Pca-100879 Procavia capensis 96.71 5.00e-103 367.00
IUUC-Ppe-101334 Prunus persica 30.31 5.00e-26 112.00
IUUC-Pva-103225 Pteropus vampyrus 79.80 0.00e+00 696.00
IUUC-Pgr-103564 Puccinia graminis 30.40 6.00e-30 125.00
IUUC-Ptt-103802 Puccinia triticina 30.23 1.00e-25 110.00
IUUC-Pte-104345 Pyrenophora teres 31.25 9.00e-28 119.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 31.18 1.00e-28 121.00
IUUC-Rno-106101 Rattus norvegicus 93.89 0.00e+00 858.00
IUUC-Sce-106460 Saccharomyces cerevisiae 29.62 1.00e-23 103.00
IUUC-Sha-106919 Sarcophilus harrisii 77.39 0.00e+00 838.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 32.17 1.00e-29 124.00
IUUC-Spo-108087 Schizosaccharomyces pombe 29.69 1.00e-27 117.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 28.93 4.00e-07 50.40
IUUC-Smo-108740 Selaginella moellendorffii 37.14 5.00e-28 118.00
IUUC-Sit-110678 Setaria italica 36.11 3.00e-25 109.00
IUUC-Sly-111526 Solanum lycopersicum 37.08 7.00e-25 108.00
IUUC-Stu-112494 Solanum tuberosum 37.08 4.00e-25 108.00
IUUC-Sar-112929 Sorex araneus 95.27 3.00e-159 555.00
IUUC-Sbi-114242 Sorghum bicolor 32.16 3.00e-27 115.00
IUUC-Sre-115224 Sporisorium reilianum 31.52 4.00e-29 123.00
IUUC-Ssc-115239 Sus scrofa 94.72 0.00e+00 861.00
IUUC-Tgu-117499 Taeniopygia guttata 87.78 0.00e+00 825.00
IUUC-Tru-118027 Takifugu rubripes 64.14 8.00e-142 496.00
IUUC-Tsy-119462 Tarsius syrichta 94.75 0.00e+00 861.00
IUUC-Tni-120855 Tetraodon nigroviridis 64.74 2.00e-175 608.00
IUUC-Tca-121213 Theobroma cacao 32.57 1.00e-24 107.00
IUUC-Tre-122186 Trichoderma reesei 31.08 8.00e-29 121.00
IUUC-Tvi-122541 Trichoderma virens 30.14 1.00e-28 121.00
IUUC-Tae-123631 Triticum aestivum 33.85 1.00e-26 114.00
IUUC-Tur-126572 Triticum urartu 37.22 4.00e-25 109.00
IUUC-Tme-127023 Tuber melanosporum 32.93 1.00e-31 131.00
IUUC-Tbe-127453 Tupaia belangeri 94.81 0.00e+00 759.00
IUUC-Ttr-128526 Tursiops truncatus 94.91 0.00e+00 864.00
IUUC-Uma-129660 Ustilago maydis 32.56 7.00e-30 126.00
IUUC-Vda-129737 Verticillium dahliae 28.52 1.00e-24 108.00
IUUC-Vpa-130505 Vicugna pacos 88.31 0.00e+00 693.00
IUUC-Vvi-131088 Vitis vinifera 35.96 2.00e-23 103.00
IUUC-Xtr-132799 Xenopus tropicalis 79.88 0.00e+00 754.00
IUUC-Xma-133345 Xiphophorus maculatus 66.01 2.00e-175 608.00
IUUC-Yli-134416 Yarrowia lipolytica 32.48 4.00e-32 132.00
IUUC-Zma-134750 Zea mays 35.56 9.00e-25 107.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved