• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • microRNA
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • PTM
    • dbPAF
    • PHOSIDA
  • Proteomics
    • GPMDB

Tag Content
UUCD2 ID IUUC-Mdo-062289
UUCD1 version UUC-MoD-00823
Ensembl Protein ID ENSMODP00000007979.3
UniProt Accession F7EZH1; F7EZH1_MONDO
Protein Name Uncharacterized protein
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMODG00000006430.3 ENSMODT00000008142.3 ENSMODP00000007979.3
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 2.20e-17 62.8 13 47
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGn +++g+CSkC+ree++++r
   Q: 13 DQSELLCKKGCGYYGNSAWQGFCSKCWREEYQKAR 47
    79******************************986 PP
   

Organism Monodelphis domestica
Protein Sequence
(Fasta)
MSLKSERRGI HVDQSELLCK KGCGYYGNSA WQGFCSKCWR EEYQKARQRQ IQEDWELAER 60
LQREEEEAFA SSQSSQGAQS LTFSKFEGKK TNEKSRKVTT VKKFFSASSR GGPKKEIQEA 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mdo-062289|UBD,ZnF_A20|Monodelphis domestica
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGAGCAAGGG GCGGGGTCTG AGCGCGCGCG CCCGATGACG GTGAGGGCGC CGGCGCCGCC 60
ATCGGCGCCG GGTCGGGGGG CGGAGCGGAG CGGGGCCGGG CCGGGCCGGG GCGTGGCTAG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mdo-062289|UBD,ZnF_A20|Monodelphis domestica
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0031982--C:vesicle
GO:0003677--F:DNA binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 31.96 1.00e-20 94.40
IUUC-Aml-001771 Ailuropoda melanoleuca 83.49 0.00e+00 713.00
IUUC-Atr-003154 Amborella trichopoda 34.48 7.00e-23 101.00
IUUC-Apl-004018 Anas platyrhynchos 89.63 0.00e+00 824.00
IUUC-Aca-005227 Anolis carolinensis 23.47 3.00e-09 57.40
IUUC-Aly-006138 Arabidopsis lyrata 35.98 1.00e-25 110.00
IUUC-Ath-006929 Arabidopsis thaliana 31.51 5.00e-27 115.00
IUUC-Ago-007776 Ashbya gossypii 30.13 4.00e-25 108.00
IUUC-Acl-008235 Aspergillus clavatus 31.32 3.00e-30 127.00
IUUC-Afl-008570 Aspergillus flavus 32.16 1.00e-32 135.00
IUUC-Afu-008815 Aspergillus fumigatus 29.87 9.00e-31 129.00
IUUC-Ani-009381 Aspergillus nidulans 31.16 4.00e-31 129.00
IUUC-Ang-009615 Aspergillus niger 31.54 4.00e-33 135.00
IUUC-Aor-010195 Aspergillus oryzae 31.94 5.00e-33 135.00
IUUC-Ate-010514 Aspergillus terreus 32.98 6.00e-32 132.00
IUUC-Ame-011365 Astyanax mexicanus 66.14 0.00e+00 667.00
IUUC-Bgr-012102 Blumeria graminis 29.71 1.00e-30 128.00
IUUC-Bta-013124 Bos taurus 93.08 0.00e+00 848.00
IUUC-Bci-013943 Botrytis cinerea 31.88 1.00e-31 131.00
IUUC-Bdi-014539 Brachypodium distachyon 34.39 2.00e-26 113.00
IUUC-Bol-016580 Brassica oleracea 35.32 9.00e-31 128.00
IUUC-Bra-017843 Brassica rapa 34.86 2.00e-30 127.00
IUUC-Cel-018199 Caenorhabditis elegans 33.59 1.00e-57 217.00
IUUC-Cja-019941 Callithrix jacchus 92.26 0.00e+00 844.00
IUUC-Cfa-020845 Canis familiaris 92.83 0.00e+00 774.00
IUUC-Cpo-022037 Cavia porcellus 93.08 0.00e+00 845.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 34.66 3.00e-22 100.00
IUUC-Csa-023272 Chlorocebus sabaeus 91.65 0.00e+00 839.00
IUUC-Cho-025076 Choloepus hoffmanni 81.67 0.00e+00 711.00
IUUC-Cin-025400 Ciona intestinalis 45.71 6.00e-117 414.00
IUUC-Csv-025941 Ciona savignyi 38.48 2.00e-85 309.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 30.43 9.00e-29 122.00
IUUC-Cne-027057 Cryptococcus neoformans 31.95 2.00e-36 147.00
IUUC-Dre-028484 Danio rerio 70.69 0.00e+00 672.00
IUUC-Dno-028906 Dasypus novemcinctus 92.48 0.00e+00 830.00
IUUC-Dor-030124 Dipodomys ordii 84.69 0.00e+00 737.00
IUUC-Dse-031437 Dothistroma septosporum 27.96 1.00e-27 118.00
IUUC-Dme-031696 Drosophila melanogaster 33.19 8.00e-70 258.00
IUUC-Ete-032573 Echinops telfairi 91.20 0.00e+00 712.00
IUUC-Eca-033711 Equus caballus 93.28 0.00e+00 851.00
IUUC-Eeu-034459 Erinaceus europaeus 69.90 2.00e-74 273.00
IUUC-Fca-035447 Felis catus 93.08 0.00e+00 859.00
IUUC-Fal-036605 Ficedula albicollis 86.65 0.00e+00 766.00
IUUC-Fox-037967 Fusarium oxysporum 27.08 4.00e-20 93.60
IUUC-Fso-038110 Fusarium solani 30.04 1.00e-30 128.00
IUUC-Gmo-038785 Gadus morhua 67.39 0.00e+00 682.00
IUUC-Ggr-039760 Gaeumannomyces graminis 30.69 5.00e-29 123.00
IUUC-Gga-040584 Gallus gallus 90.24 0.00e+00 826.00
IUUC-Gac-042317 Gasterosteus aculeatus 63.83 7.00e-160 556.00
IUUC-Gma-044237 Glycine max 35.29 3.00e-26 113.00
IUUC-Ggo-044498 Gorilla gorilla 79.67 0.00e+00 697.00
IUUC-Hsa-046625 Homo sapiens 92.06 0.00e+00 842.00
IUUC-Hvu-047155 Hordeum vulgare 37.78 2.00e-26 113.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 92.46 0.00e+00 843.00
IUUC-Kpa-049160 Komagataella pastoris 29.89 6.00e-26 112.00
IUUC-Lch-050529 Latimeria chalumnae 76.82 0.00e+00 830.00
IUUC-Lpe-051024 Leersia perrieri 34.84 7.00e-29 121.00
IUUC-Loc-052644 Lepisosteus oculatus 68.16 0.00e+00 640.00
IUUC-Lma-053102 Leptosphaeria maculans 30.82 2.00e-29 124.00
IUUC-Laf-054337 Loxodonta africana 91.45 0.00e+00 842.00
IUUC-Mcc-055659 Macaca mulatta 85.25 3.00e-170 591.00
IUUC-Meu-056084 Macropus eugenii 78.28 3.00e-96 345.00
IUUC-Mor-057255 Magnaporthe oryzae 29.60 2.00e-28 121.00
IUUC-Mpo-057454 Magnaporthe poae 30.69 7.00e-31 129.00
IUUC-Mtr-058098 Medicago truncatula 34.55 1.00e-30 127.00
IUUC-Mla-059068 Melampsora laricipopulina 30.00 6.00e-32 131.00
IUUC-Mga-059624 Meleagris gallopavo 76.95 0.00e+00 815.00
IUUC-Mvi-060282 Microbotryum violaceum 28.22 7.00e-26 112.00
IUUC-Mmr-061142 Microcebus murinus 93.28 0.00e+00 858.00
IUUC-Mmu-063961 Mus musculus 92.87 0.00e+00 844.00
IUUC-Mac-065188 Musa acuminata 33.07 9.00e-23 101.00
IUUC-Mpu-066291 Mustela putorius furo 92.28 0.00e+00 840.00
IUUC-Mlu-067431 Myotis lucifugus 88.82 0.00e+00 801.00
IUUC-Nfi-068422 Neosartorya fischeri 31.07 5.00e-31 129.00
IUUC-Ncr-068843 Neurospora crassa 30.29 3.00e-30 126.00
IUUC-Nle-069079 Nomascus leucogenys 92.26 0.00e+00 843.00
IUUC-Opr-070790 Ochotona princeps 90.74 1.00e-54 207.00
IUUC-Ont-071789 Oreochromis niloticus 67.51 4.00e-176 610.00
IUUC-Oan-072946 Ornithorhynchus anatinus 90.67 0.00e+00 823.00
IUUC-Ocu-073816 Oryctolagus cuniculus 92.68 0.00e+00 840.00
IUUC-Oba-075738 Oryza barthii 30.43 8.00e-18 84.70
IUUC-Obr-076355 Oryza brachyantha 37.91 2.00e-27 116.00
IUUC-Ogl-077592 Oryza glaberrima 29.13 9.00e-29 120.00
IUUC-Ogu-078197 Oryza glumaepatula 29.13 2.00e-28 120.00
IUUC-Oin-080047 Oryza indica 33.62 5.00e-26 112.00
IUUC-Olo-080317 Oryza longistaminata 29.13 2.00e-28 119.00
IUUC-Ome-081589 Oryza meridionalis 33.62 2.00e-26 114.00
IUUC-Oni-082700 Oryza nivara 30.43 6.00e-18 85.10
IUUC-Opu-083923 Oryza punctata 33.74 3.00e-21 95.50
IUUC-Oru-084318 Oryza rufipogon 30.43 6.00e-18 85.10
IUUC-Osa-086246 Oryza sativa 38.98 9.00e-07 44.70
IUUC-Ola-086334 Oryzias latipes 58.97 3.00e-164 571.00
IUUC-Olu-087719 Ostreococcus lucimarinus 32.97 7.00e-24 105.00
IUUC-Oga-088992 Otolemur garnettii 80.99 0.00e+00 844.00
IUUC-Oar-089789 Ovis aries 92.70 0.00e+00 840.00
IUUC-Ptr-091636 Pan troglodytes 92.06 0.00e+00 840.00
IUUC-Pan-092911 Papio anubis 91.85 0.00e+00 842.00
IUUC-Psi-093194 Pelodiscus sinensis 77.57 0.00e+00 815.00
IUUC-Pma-094212 Petromyzon marinus 47.89 3.00e-112 398.00
IUUC-Pno-094831 Phaeosphaeria nodorum 30.29 7.00e-29 122.00
IUUC-Ppa-095705 Physcomitrella patens 35.64 1.00e-29 124.00
IUUC-Pfo-096694 Poecilia formosa 64.62 2.00e-179 622.00
IUUC-Pab-097706 Pongo abelii 91.85 0.00e+00 838.00
IUUC-Pop-099891 Populus trichocarpa 37.43 1.00e-25 111.00
IUUC-Pca-100879 Procavia capensis 88.26 1.00e-86 313.00
IUUC-Ppe-101334 Prunus persica 31.50 7.00e-28 118.00
IUUC-Pva-103225 Pteropus vampyrus 78.18 0.00e+00 681.00
IUUC-Pgr-103564 Puccinia graminis 30.38 2.00e-31 131.00
IUUC-Ptt-103802 Puccinia triticina 30.62 1.00e-27 118.00
IUUC-Pte-104345 Pyrenophora teres 29.47 5.00e-29 123.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 29.75 6.00e-30 126.00
IUUC-Rno-106101 Rattus norvegicus 93.08 0.00e+00 847.00
IUUC-Sce-106460 Saccharomyces cerevisiae 30.39 3.00e-27 115.00
IUUC-Sha-106919 Sarcophilus harrisii 81.45 0.00e+00 858.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 32.99 3.00e-32 133.00
IUUC-Spo-108087 Schizosaccharomyces pombe 30.23 4.00e-29 122.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 29.79 8.00e-08 52.40
IUUC-Smo-108740 Selaginella moellendorffii 36.17 7.00e-29 121.00
IUUC-Sit-110678 Setaria italica 35.15 1.00e-26 114.00
IUUC-Sly-111526 Solanum lycopersicum 37.85 1.00e-25 111.00
IUUC-Stu-112494 Solanum tuberosum 38.42 3.00e-26 112.00
IUUC-Sar-112929 Sorex araneus 95.64 2.00e-159 555.00
IUUC-Sbi-114242 Sorghum bicolor 32.30 1.00e-28 120.00
IUUC-Sre-115224 Sporisorium reilianum 31.34 7.00e-31 129.00
IUUC-Ssc-115239 Sus scrofa 93.09 0.00e+00 845.00
IUUC-Tgu-117499 Taeniopygia guttata 88.39 0.00e+00 808.00
IUUC-Tru-118450 Takifugu rubripes 58.65 6.00e-167 580.00
IUUC-Tsy-119462 Tarsius syrichta 92.86 0.00e+00 826.00
IUUC-Tni-120855 Tetraodon nigroviridis 63.49 1.00e-173 602.00
IUUC-Tca-121213 Theobroma cacao 35.98 1.00e-25 110.00
IUUC-Tre-122186 Trichoderma reesei 29.55 5.00e-30 125.00
IUUC-Tvi-122541 Trichoderma virens 27.97 8.00e-30 125.00
IUUC-Tae-123631 Triticum aestivum 34.63 2.00e-27 117.00
IUUC-Tur-126572 Triticum urartu 38.89 2.00e-26 114.00
IUUC-Tme-127023 Tuber melanosporum 33.33 6.00e-34 139.00
IUUC-Tbe-127453 Tupaia belangeri 92.99 0.00e+00 747.00
IUUC-Ttr-128526 Tursiops truncatus 92.46 0.00e+00 843.00
IUUC-Uma-129660 Ustilago maydis 31.76 3.00e-31 130.00
IUUC-Vda-129737 Verticillium dahliae 30.07 1.00e-25 112.00
IUUC-Vpa-130505 Vicugna pacos 86.23 0.00e+00 681.00
IUUC-Vvi-131088 Vitis vinifera 37.08 6.00e-24 105.00
IUUC-Xtr-132799 Xenopus tropicalis 80.49 0.00e+00 739.00
IUUC-Xma-133345 Xiphophorus maculatus 65.23 4.00e-175 607.00
IUUC-Yli-134416 Yarrowia lipolytica 31.54 2.00e-33 137.00
IUUC-Zma-134750 Zea mays 37.22 4.00e-26 112.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved