• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Apl-003473
Ensembl Protein ID ENSAPLP00000005949.1
UniProt Accession U3IFC7; U3IFC7_ANAPL
Genbank Protein ID ENSAPLP00000005949
Protein Name Uncharacterized protein
Genbank Nucleotide ID ADON01129395
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSAPLG00000006338.1 ENSAPLT00000006585.1 ENSAPLP00000005949.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 2.40e-62 208.7 2 143
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 3    sesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvkek 91
    s+++l k ++yk+++ltv+e+ +i++yk+lkp+++s+v+nDg+sreL++l Gtipvp+rg+tynipi+lwll+tYP +PP+++vk++
   Q: 2 SQNHLMKWSPEYKYRDLTVQETTSVITQYKDLKPVMDSYVFNDGSSRELMSLSGTIPVPYRGNTYNIPICLWLLDTYPFNPPICFVKPT 90
    678889999******************************************************************************** PP
   S: 92 idmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+el+q++iv++++epp++srp
   Q: 91 SSM-TIKTG-KHVDANGKIYLPYLHEWKYPQSDLLELIQVMIVVFGEEPPVFSRP 143
    ***.*****.*******************************************98 PP
   

Organism Anas platyrhynchos
Protein Sequence
(Fasta)
LSQNHLMKWS PEYKYRDLTV QETTSVITQY KDLKPVMDSY VFNDGSSREL MSLSGTIPVP 60
YRGNTYNIPI CLWLLDTYPF NPPICFVKPT SSMTIKTGKH VDANGKIYLP YLHEWKYPQS 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Apl-003473|UBD,UBD_UEV|Anas platyrhynchos
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTTTCCCAAA ATCACTTGAT GTATGGACTC TTATTTGAGA ATAAAAGCAT CCTAACGTGT 60
TAAAATTGGG TAAATTATAT AGGAAGTGGA GCCCAGAAGA ATGTCCATAT ATTATCAGTA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Apl-003473|UBD,UBD_UEV|Anas platyrhynchos
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 26.90 2.00e-26 113.00
IUUC-Aml-002415 Ailuropoda melanoleuca 87.76 0.00e+00 674.00
IUUC-Atr-002875 Amborella trichopoda 30.08 6.00e-39 154.00
IUUC-Aca-004573 Anolis carolinensis 86.73 0.00e+00 656.00
IUUC-Aly-006084 Arabidopsis lyrata 38.52 1.00e-22 100.00
IUUC-Ath-006575 Arabidopsis thaliana 31.27 2.00e-33 136.00
IUUC-Ago-007755 Ashbya gossypii 22.36 2.00e-06 46.20
IUUC-Acl-008218 Aspergillus clavatus 37.06 5.00e-26 112.00
IUUC-Afl-008597 Aspergillus flavus 39.53 2.00e-26 113.00
IUUC-Afu-009017 Aspergillus fumigatus 35.71 5.00e-24 105.00
IUUC-Ani-009468 Aspergillus nidulans 39.26 6.00e-22 98.60
IUUC-Ang-009755 Aspergillus niger 35.61 4.00e-23 102.00
IUUC-Aor-010072 Aspergillus oryzae 39.53 2.00e-26 113.00
IUUC-Ate-010400 Aspergillus terreus 38.52 3.00e-26 113.00
IUUC-Ame-011620 Astyanax mexicanus 81.12 6.00e-180 622.00
IUUC-Bgr-012136 Blumeria graminis 35.14 7.00e-25 108.00
IUUC-Bta-012557 Bos taurus 88.24 0.00e+00 684.00
IUUC-Bci-013881 Botrytis cinerea 36.73 5.00e-28 118.00
IUUC-Bdi-014325 Brachypodium distachyon 31.03 3.00e-15 75.50
IUUC-Bol-015933 Brassica oleracea 43.33 1.00e-24 107.00
IUUC-Bra-017442 Brassica rapa 43.33 6.00e-25 107.00
IUUC-Cel-018697 Caenorhabditis elegans 48.84 9.00e-37 147.00
IUUC-Cja-018963 Callithrix jacchus 84.69 0.00e+00 662.00
IUUC-Cfa-020472 Canis familiaris 87.50 0.00e+00 669.00
IUUC-Cpo-022001 Cavia porcellus 89.29 0.00e+00 678.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 30.38 9.00e-34 137.00
IUUC-Csa-023959 Chlorocebus sabaeus 89.29 0.00e+00 647.00
IUUC-Cho-024389 Choloepus hoffmanni 55.77 6.00e-35 141.00
IUUC-Cin-025688 Ciona intestinalis 46.17 6.00e-100 357.00
IUUC-Cne-026904 Cryptococcus neoformans 32.16 1.00e-16 81.30
IUUC-Cme-027280 Cyanidioschyzon merolae 37.40 4.00e-19 88.20
IUUC-Dre-027913 Danio rerio 81.12 5.00e-170 589.00
IUUC-Dno-029672 Dasypus novemcinctus 88.27 0.00e+00 682.00
IUUC-Dor-030175 Dipodomys ordii 87.19 3.00e-89 321.00
IUUC-Dse-031375 Dothistroma septosporum 35.11 3.00e-24 106.00
IUUC-Dme-031736 Drosophila melanogaster 47.93 7.00e-96 343.00
IUUC-Ete-032343 Echinops telfairi 85.46 0.00e+00 646.00
IUUC-Eca-033926 Equus caballus 88.01 0.00e+00 667.00
IUUC-Eeu-034940 Erinaceus europaeus 82.91 0.00e+00 654.00
IUUC-Fca-035491 Felis catus 85.46 0.00e+00 662.00
IUUC-Fal-037508 Ficedula albicollis 93.62 0.00e+00 702.00
IUUC-Fox-037937 Fusarium oxysporum 32.62 1.00e-23 104.00
IUUC-Fso-038091 Fusarium solani 36.05 2.00e-27 116.00
IUUC-Gmo-039427 Gadus morhua 77.32 2.00e-165 574.00
IUUC-Ggr-039724 Gaeumannomyces graminis 37.24 8.00e-27 115.00
IUUC-Gga-040998 Gallus gallus 93.11 0.00e+00 743.00
IUUC-Gac-041356 Gasterosteus aculeatus 78.89 0.00e+00 625.00
IUUC-Gma-043566 Glycine max 40.48 1.00e-26 113.00
IUUC-Ggo-044967 Gorilla gorilla 89.29 0.00e+00 647.00
IUUC-Hsa-046686 Homo sapiens 89.29 0.00e+00 647.00
IUUC-Hvu-047430 Hordeum vulgare 27.45 9.00e-27 114.00
IUUC-Itr-047929 Ictidomys tridecemlineatus 98.45 3.00e-108 383.00
IUUC-Kpa-049287 Komagataella pastoris 31.41 5.00e-19 88.60
IUUC-Lch-050597 Latimeria chalumnae 82.91 0.00e+00 676.00
IUUC-Lpe-051090 Leersia perrieri 36.22 3.00e-21 95.50
IUUC-Loc-052399 Lepisosteus oculatus 80.68 4.00e-172 596.00
IUUC-Lma-053249 Leptosphaeria maculans 31.58 5.00e-14 72.40
IUUC-Laf-053766 Loxodonta africana 88.78 0.00e+00 676.00
IUUC-Mcc-055641 Macaca mulatta 89.29 0.00e+00 647.00
IUUC-Meu-055919 Macropus eugenii 87.84 1.00e-164 571.00
IUUC-Mor-056970 Magnaporthe oryzae 37.59 2.00e-26 113.00
IUUC-Mpo-057345 Magnaporthe poae 36.17 2.00e-24 106.00
IUUC-Mtr-058436 Medicago truncatula 40.48 1.00e-27 117.00
IUUC-Mla-059037 Melampsora laricipopulina 38.35 2.00e-25 110.00
IUUC-Mga-059263 Meleagris gallopavo 94.56 0.00e+00 748.00
IUUC-Mvi-060463 Microbotryum violaceum 31.16 5.00e-17 82.40
IUUC-Mmr-060915 Microcebus murinus 88.27 0.00e+00 672.00
IUUC-Mdo-062449 Monodelphis domestica 86.67 0.00e+00 651.00
IUUC-Mmu-063151 Mus musculus 86.48 0.00e+00 659.00
IUUC-Mac-065581 Musa acuminata 36.43 5.00e-23 101.00
IUUC-Mpu-066621 Mustela putorius furo 87.76 0.00e+00 674.00
IUUC-Mlu-067336 Myotis lucifugus 88.52 0.00e+00 657.00
IUUC-Nfi-068530 Neosartorya fischeri 36.43 3.00e-24 106.00
IUUC-Ncr-068785 Neurospora crassa 36.05 3.00e-27 116.00
IUUC-Nle-069972 Nomascus leucogenys 89.29 0.00e+00 647.00
IUUC-Opr-071150 Ochotona princeps 59.18 2.00e-109 388.00
IUUC-Ont-071366 Oreochromis niloticus 77.30 3.00e-180 624.00
IUUC-Oan-073290 Ornithorhynchus anatinus 95.88 7.00e-106 375.00
IUUC-Ocu-074351 Oryctolagus cuniculus 89.03 0.00e+00 677.00
IUUC-Oba-075338 Oryza barthii 35.71 3.00e-11 62.00
IUUC-Obr-076135 Oryza brachyantha 35.43 5.00e-21 95.10
IUUC-Ogl-077182 Oryza glaberrima 34.45 7.00e-18 84.70
IUUC-Ogu-078281 Oryza glumaepatula 27.53 1.00e-26 113.00
IUUC-Oin-079068 Oryza indica 37.38 2.00e-17 83.60
IUUC-Olo-080460 Oryza longistaminata 35.80 1.00e-08 52.40
IUUC-Ome-081781 Oryza meridionalis 27.27 4.00e-26 112.00
IUUC-Oni-082517 Oryza nivara 26.98 7.00e-25 108.00
IUUC-Opu-084101 Oryza punctata 25.46 4.00e-18 85.10
IUUC-Oru-084556 Oryza rufipogon 37.96 9.00e-18 84.30
IUUC-Osa-086264 Oryza sativa 34.45 7.00e-18 84.70
IUUC-Ola-087252 Oryzias latipes 93.29 1.00e-69 254.00
IUUC-Olu-087610 Ostreococcus lucimarinus 28.65 4.00e-16 78.60
IUUC-Oga-088304 Otolemur garnettii 88.52 0.00e+00 676.00
IUUC-Oar-089734 Ovis aries 88.24 0.00e+00 684.00
IUUC-Ptr-091476 Pan troglodytes 89.29 0.00e+00 647.00
IUUC-Pan-092341 Papio anubis 89.29 0.00e+00 647.00
IUUC-Psi-093470 Pelodiscus sinensis 92.13 0.00e+00 673.00
IUUC-Pma-094143 Petromyzon marinus 66.30 1.00e-134 472.00
IUUC-Pno-095069 Phaeosphaeria nodorum 35.85 7.00e-15 75.10
IUUC-Ppa-095933 Physcomitrella patens 32.14 5.00e-41 161.00
IUUC-Pfo-096321 Poecilia formosa 79.08 6.00e-171 592.00
IUUC-Pab-098527 Pongo abelii 88.14 6.00e-164 569.00
IUUC-Pop-099323 Populus trichocarpa 28.85 1.00e-37 150.00
IUUC-Pca-101044 Procavia capensis 70.15 5.00e-142 496.00
IUUC-Ppe-101458 Prunus persica 43.33 2.00e-28 119.00
IUUC-Pva-103014 Pteropus vampyrus 78.57 2.00e-157 547.00
IUUC-Pgr-103615 Puccinia graminis 38.89 9.00e-22 98.20
IUUC-Ptt-103826 Puccinia triticina 39.60 3.00e-17 82.80
IUUC-Pte-104171 Pyrenophora teres 36.09 2.00e-22 100.00
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 1.00e-10 60.80
IUUC-Rno-105957 Rattus norvegicus 85.71 0.00e+00 652.00
IUUC-Sce-106262 Saccharomyces cerevisiae 26.87 1.00e-11 63.50
IUUC-Sha-107607 Sarcophilus harrisii 90.06 1.00e-170 592.00
IUUC-Spo-108175 Schizosaccharomyces pombe 30.56 7.00e-03 35.00
IUUC-Ssl-108672 Sclerotinia sclerotiorum 35.37 4.00e-27 115.00
IUUC-Smo-108973 Selaginella moellendorffii 38.46 5.00e-22 98.20
IUUC-Sly-111373 Solanum lycopersicum 39.68 2.00e-25 109.00
IUUC-Stu-112844 Solanum tuberosum 38.89 3.00e-24 105.00
IUUC-Sar-113653 Sorex araneus 77.30 3.00e-166 577.00
IUUC-Sbi-114390 Sorghum bicolor 33.86 4.00e-21 95.50
IUUC-Sre-115200 Sporisorium reilianum 44.25 4.00e-24 105.00
IUUC-Ssc-115888 Sus scrofa 89.57 1.00e-108 384.00
IUUC-Tgu-117506 Taeniopygia guttata 94.39 0.00e+00 728.00
IUUC-Tru-118063 Takifugu rubripes 78.17 2.00e-166 577.00
IUUC-Tsy-118851 Tarsius syrichta 69.80 2.00e-133 468.00
IUUC-Tni-120010 Tetraodon nigroviridis 77.22 3.00e-166 577.00
IUUC-Tca-121182 Theobroma cacao 41.27 6.00e-24 104.00
IUUC-Tre-122040 Trichoderma reesei 35.46 2.00e-24 106.00
IUUC-Tvi-122660 Trichoderma virens 38.10 1.00e-27 117.00
IUUC-Tae-124561 Triticum aestivum 26.90 2.00e-26 113.00
IUUC-Tur-126651 Triticum urartu 36.22 1.00e-21 96.70
IUUC-Tme-127184 Tuber melanosporum 42.22 1.00e-26 114.00
IUUC-Tbe-127894 Tupaia belangeri 78.33 3.00e-84 304.00
IUUC-Ttr-128264 Tursiops truncatus 82.61 0.00e+00 647.00
IUUC-Uma-129407 Ustilago maydis 39.85 1.00e-24 107.00
IUUC-Vda-130002 Verticillium dahliae 30.19 8.00e-19 87.80
IUUC-Vpa-130156 Vicugna pacos 82.27 5.00e-86 310.00
IUUC-Vvi-131479 Vitis vinifera 40.48 3.00e-25 108.00
IUUC-Xtr-132332 Xenopus tropicalis 82.44 1.00e-62 231.00
IUUC-Xma-133186 Xiphophorus maculatus 78.32 8.00e-173 599.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 4.00e-13 68.60
IUUC-Zma-135391 Zea mays 34.40 9.00e-21 94.40
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved