• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • dbPAF
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Psi-093470
Ensembl Protein ID ENSPSIP00000002704.1
UniProt Accession K7F3U4; K7F3U4_PELSI
Genbank Protein ID ENSPSIP00000002704
Protein Name Uncharacterized protein
Genbank Nucleotide ID AGCU01155220
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSPSIG00000002634.1 ENSPSIT00000002713.1 ENSPSIP00000002704.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 6.10e-61 204.4 6 138
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 12   skykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvkekidmntikss 100
    +yk+++ltv+e+ +i++yk+lkp+++++v+nDg+sr L++ltGtipvp+rg+tynipi+lwll+tYP +PP+++vk++++m tik++
   Q: 6 FQYKYRDLTVQETTSVITQYKDLKPVMDAYVFNDGSSRDLMSLTGTIPVPYRGNTYNIPICLWLLDTYPFNPPICFVKPTSSM-TIKTG 93
    58999******************************************************************************.***** PP
   S: 101 nehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 94 -KHVDANGKIYLPYLHEWKHPQSDLIGLIQIMIVVFGEEPPVFSRP 138
    .*******************************************98 PP
   

Organism Pelodiscus sinensis
Protein Sequence
(Fasta)
LNAFVFQYKY RDLTVQETTS VITQYKDLKP VMDAYVFNDG SSRDLMSLTG TIPVPYRGNT 60
YNIPICLWLL DTYPFNPPIC FVKPTSSMTI KTGKHVDANG KIYLPYLHEW KHPQSDLIGL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Psi-093470|UBD,UBD_UEV|Pelodiscus sinensis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TTAAATGCTT TTGTTTTTCA GTATAAATAC AGAGATCTCA CGGTGCAGGA AACCACTAGT 60
GTTATTACCC AGTACAAAGA CCTCAAACCT GTAATGGATG CATATGGTGA GTTGAGCATA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Psi-093470|UBD,UBD_UEV|Pelodiscus sinensis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 38.26 1.00e-20 94.00
IUUC-Aml-002415 Ailuropoda melanoleuca 91.69 0.00e+00 686.00
IUUC-Atr-002875 Amborella trichopoda 27.42 3.00e-35 142.00
IUUC-Apl-003473 Anas platyrhynchos 92.13 0.00e+00 684.00
IUUC-Aca-004573 Anolis carolinensis 91.17 0.00e+00 665.00
IUUC-Aly-006164 Arabidopsis lyrata 43.14 8.00e-22 97.80
IUUC-Ath-006575 Arabidopsis thaliana 43.14 7.00e-22 98.20
IUUC-Ago-007755 Ashbya gossypii 25.69 1.00e-06 47.40
IUUC-Acl-008218 Aspergillus clavatus 39.53 5.00e-26 112.00
IUUC-Afl-008597 Aspergillus flavus 41.09 6.00e-27 115.00
IUUC-Afu-009017 Aspergillus fumigatus 38.10 5.00e-24 105.00
IUUC-Ani-009468 Aspergillus nidulans 37.21 4.00e-21 96.30
IUUC-Ang-009755 Aspergillus niger 38.10 3.00e-23 103.00
IUUC-Aor-010072 Aspergillus oryzae 39.26 5.00e-27 115.00
IUUC-Ate-010400 Aspergillus terreus 38.76 9.00e-26 111.00
IUUC-Ame-011620 Astyanax mexicanus 85.19 0.00e+00 647.00
IUUC-Bgr-012136 Blumeria graminis 35.82 3.00e-23 102.00
IUUC-Bta-012557 Bos taurus 92.21 0.00e+00 682.00
IUUC-Bci-013881 Botrytis cinerea 38.69 3.00e-27 115.00
IUUC-Bdi-014325 Brachypodium distachyon 30.17 3.00e-14 72.40
IUUC-Bol-016308 Brassica oleracea 41.60 4.00e-27 115.00
IUUC-Bra-017442 Brassica rapa 41.03 8.00e-24 104.00
IUUC-Cel-018697 Caenorhabditis elegans 48.84 3.00e-37 149.00
IUUC-Cja-018963 Callithrix jacchus 85.45 0.00e+00 649.00
IUUC-Cfa-020472 Canis familiaris 91.69 0.00e+00 684.00
IUUC-Cpo-022001 Cavia porcellus 93.51 0.00e+00 693.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 30.05 4.00e-30 125.00
IUUC-Csa-023959 Chlorocebus sabaeus 92.99 0.00e+00 657.00
IUUC-Cho-024389 Choloepus hoffmanni 55.45 5.00e-36 145.00
IUUC-Cin-025688 Ciona intestinalis 46.11 2.00e-99 355.00
IUUC-Cne-026904 Cryptococcus neoformans 32.28 1.00e-15 77.40
IUUC-Cme-027280 Cyanidioschyzon merolae 37.40 3.00e-19 89.00
IUUC-Dre-027913 Danio rerio 84.16 2.00e-178 617.00
IUUC-Dno-029672 Dasypus novemcinctus 91.95 0.00e+00 682.00
IUUC-Dor-030175 Dipodomys ordii 95.02 2.00e-92 332.00
IUUC-Dse-031375 Dothistroma septosporum 33.58 2.00e-23 103.00
IUUC-Dme-031736 Drosophila melanogaster 46.30 5.00e-93 334.00
IUUC-Ete-032343 Echinops telfairi 87.79 0.00e+00 655.00
IUUC-Eca-033926 Equus caballus 92.21 0.00e+00 682.00
IUUC-Eeu-034940 Erinaceus europaeus 84.94 0.00e+00 647.00
IUUC-Fca-035491 Felis catus 91.43 0.00e+00 670.00
IUUC-Fal-037508 Ficedula albicollis 91.43 0.00e+00 669.00
IUUC-Fox-037937 Fusarium oxysporum 33.59 2.00e-21 97.10
IUUC-Fso-038091 Fusarium solani 37.23 3.00e-25 109.00
IUUC-Gmo-039427 Gadus morhua 82.08 1.00e-171 595.00
IUUC-Ggr-039724 Gaeumannomyces graminis 37.78 2.00e-24 106.00
IUUC-Gga-040998 Gallus gallus 88.05 0.00e+00 671.00
IUUC-Gac-041356 Gasterosteus aculeatus 84.42 0.00e+00 644.00
IUUC-Gma-043566 Glycine max 38.89 4.00e-26 112.00
IUUC-Ggo-044967 Gorilla gorilla 92.99 0.00e+00 657.00
IUUC-Hsa-046686 Homo sapiens 92.99 0.00e+00 657.00
IUUC-Hvu-047430 Hordeum vulgare 38.26 1.00e-20 94.00
IUUC-Itr-047929 Ictidomys tridecemlineatus 96.89 7.00e-109 385.00
IUUC-Kpa-049287 Komagataella pastoris 31.03 2.00e-17 83.20
IUUC-Lch-050597 Latimeria chalumnae 85.97 0.00e+00 650.00
IUUC-Lpe-051090 Leersia perrieri 38.26 3.00e-20 92.40
IUUC-Loc-052399 Lepisosteus oculatus 86.02 3.00e-176 610.00
IUUC-Lma-053249 Leptosphaeria maculans 29.82 9.00e-14 71.60
IUUC-Laf-053766 Loxodonta africana 92.99 0.00e+00 691.00
IUUC-Mcc-055641 Macaca mulatta 92.99 0.00e+00 657.00
IUUC-Meu-055919 Macropus eugenii 89.91 3.00e-167 580.00
IUUC-Mor-056970 Magnaporthe oryzae 39.69 9.00e-25 108.00
IUUC-Mpo-057345 Magnaporthe poae 36.64 1.00e-21 97.40
IUUC-Mtr-058436 Medicago truncatula 39.68 5.00e-27 115.00
IUUC-Mla-059037 Melampsora laricipopulina 35.66 3.00e-25 109.00
IUUC-Mga-059263 Meleagris gallopavo 90.03 0.00e+00 666.00
IUUC-Mvi-060463 Microbotryum violaceum 30.87 1.00e-17 84.70
IUUC-Mmr-060915 Microcebus murinus 92.73 0.00e+00 685.00
IUUC-Mdo-062449 Monodelphis domestica 90.39 0.00e+00 655.00
IUUC-Mmu-063151 Mus musculus 90.39 0.00e+00 665.00
IUUC-Mac-065581 Musa acuminata 36.43 2.00e-22 99.80
IUUC-Mpu-066621 Mustela putorius furo 91.69 0.00e+00 686.00
IUUC-Mlu-067336 Myotis lucifugus 92.73 0.00e+00 668.00
IUUC-Nfi-068530 Neosartorya fischeri 38.89 4.00e-24 105.00
IUUC-Ncr-068785 Neurospora crassa 36.50 1.00e-24 107.00
IUUC-Nle-069972 Nomascus leucogenys 92.99 0.00e+00 657.00
IUUC-Opr-071150 Ochotona princeps 63.64 1.00e-112 399.00
IUUC-Ont-071366 Oreochromis niloticus 83.64 0.00e+00 648.00
IUUC-Oan-073290 Ornithorhynchus anatinus 95.65 3.00e-107 380.00
IUUC-Ocu-074351 Oryctolagus cuniculus 92.73 0.00e+00 688.00
IUUC-Oba-075338 Oryza barthii 39.06 2.00e-11 62.40
IUUC-Obr-076135 Oryza brachyantha 38.26 2.00e-20 93.60
IUUC-Ogl-077182 Oryza glaberrima 37.38 2.00e-17 83.20
IUUC-Ogu-078281 Oryza glumaepatula 38.26 1.00e-20 93.60
IUUC-Oin-079068 Oryza indica 37.38 4.00e-17 82.40
IUUC-Olo-080460 Oryza longistaminata 35.80 9.00e-09 52.40
IUUC-Ome-081781 Oryza meridionalis 36.21 5.00e-18 85.10
IUUC-Oni-082517 Oryza nivara 26.09 4.00e-17 82.40
IUUC-Opu-084101 Oryza punctata 37.96 2.00e-17 83.20
IUUC-Oru-084556 Oryza rufipogon 37.96 2.00e-17 83.20
IUUC-Osa-086264 Oryza sativa 37.38 2.00e-17 83.20
IUUC-Ola-087252 Oryzias latipes 93.29 4.00e-69 252.00
IUUC-Olu-087610 Ostreococcus lucimarinus 26.21 7.00e-13 68.20
IUUC-Oga-088304 Otolemur garnettii 92.47 0.00e+00 687.00
IUUC-Oar-089734 Ovis aries 92.21 0.00e+00 682.00
IUUC-Ptr-091476 Pan troglodytes 92.99 0.00e+00 657.00
IUUC-Pan-092341 Papio anubis 92.99 0.00e+00 657.00
IUUC-Pma-094143 Petromyzon marinus 63.66 1.00e-129 455.00
IUUC-Pno-095069 Phaeosphaeria nodorum 33.96 3.00e-15 76.60
IUUC-Ppa-095933 Physcomitrella patens 29.49 4.00e-37 148.00
IUUC-Pfo-096321 Poecilia formosa 83.90 3.00e-176 610.00
IUUC-Pab-098527 Pongo abelii 92.22 3.00e-167 580.00
IUUC-Pop-099323 Populus trichocarpa 27.86 5.00e-37 148.00
IUUC-Pca-101044 Procavia capensis 74.55 2.00e-146 511.00
IUUC-Ppe-101458 Prunus persica 41.67 1.00e-27 117.00
IUUC-Pva-103014 Pteropus vampyrus 82.34 8.00e-161 559.00
IUUC-Pgr-103615 Puccinia graminis 36.84 8.00e-22 98.20
IUUC-Ptt-103826 Puccinia triticina 40.59 6.00e-17 82.00
IUUC-Pte-104171 Pyrenophora teres 36.51 2.00e-21 97.10
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 2.00e-10 60.10
IUUC-Rno-105957 Rattus norvegicus 89.35 0.00e+00 658.00
IUUC-Sce-106262 Saccharomyces cerevisiae 28.47 2.00e-12 66.20
IUUC-Sha-107607 Sarcophilus harrisii 93.71 6.00e-173 599.00
IUUC-Spo-108175 Schizosaccharomyces pombe 30.56 1.10e-02 34.70
IUUC-Ssl-108672 Sclerotinia sclerotiorum 37.23 4.00e-26 112.00
IUUC-Smo-108973 Selaginella moellendorffii 35.11 2.00e-21 96.30
IUUC-Sly-111373 Solanum lycopersicum 37.30 1.00e-24 107.00
IUUC-Stu-112512 Solanum tuberosum 34.92 3.00e-22 99.40
IUUC-Sar-113653 Sorex araneus 78.18 2.00e-166 577.00
IUUC-Sbi-114390 Sorghum bicolor 33.86 2.00e-20 93.20
IUUC-Sre-115200 Sporisorium reilianum 43.36 9.00e-24 105.00
IUUC-Ssc-115888 Sus scrofa 96.49 5.00e-111 392.00
IUUC-Tgu-117506 Taeniopygia guttata 89.15 0.00e+00 675.00
IUUC-Tru-118063 Takifugu rubripes 80.62 6.00e-174 603.00
IUUC-Tsy-118851 Tarsius syrichta 71.63 4.00e-133 467.00
IUUC-Tni-120010 Tetraodon nigroviridis 81.96 3.00e-171 593.00
IUUC-Tca-121182 Theobroma cacao 40.48 1.00e-23 103.00
IUUC-Tre-122040 Trichoderma reesei 35.88 4.00e-22 99.40
IUUC-Tvi-122660 Trichoderma virens 39.42 4.00e-26 112.00
IUUC-Tae-124561 Triticum aestivum 38.26 1.00e-20 94.00
IUUC-Tur-126651 Triticum urartu 38.26 2.00e-20 93.20
IUUC-Tme-127184 Tuber melanosporum 46.43 2.00e-26 113.00
IUUC-Tbe-127894 Tupaia belangeri 100.00 7.00e-81 293.00
IUUC-Ttr-128264 Tursiops truncatus 84.68 0.00e+00 641.00
IUUC-Uma-129407 Ustilago maydis 37.86 2.00e-24 107.00
IUUC-Vda-130002 Verticillium dahliae 32.12 7.00e-17 81.60
IUUC-Vpa-130156 Vicugna pacos 88.06 6.00e-91 327.00
IUUC-Vvi-131062 Vitis vinifera 29.04 2.00e-33 135.00
IUUC-Xtr-132332 Xenopus tropicalis 82.44 3.00e-64 236.00
IUUC-Xma-133186 Xiphophorus maculatus 83.64 7.00e-176 609.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 1.00e-12 67.40
IUUC-Zma-135391 Zea mays 34.40 4.00e-20 92.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved