• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • CPLM
    • BioGRID
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
UUCD2 ID IUUC-Cel-018119
UUCD1 version UUC-CaE-00686
Ensembl Protein ID Y54G2A.31
UniProt Accession Q95XX0; UBC13_CAEEL
Genbank Protein ID CCD83521.1
Protein Name Ubiquitin-conjugating enzyme E2 13
Genbank Nucleotide ID BX284604
Gene Name ubc-13; Y54G2A.31
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
WBGene00006708 Y54G2A.31 Y54G2A.31
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEO
DNA & RNA Element
microRNARAID2
Protein-protein Interaction
IIDiRefIndexMentha
Protein Expression/Proteomics
GPMDB
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.00e-47 161.7 8 142
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388}
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkeeekWspalsves 100
    R+ ke+++l +dp++gisa+p+++ + ++v+i Gp+d+p++ggvFkle+ +pe+YP+ +Pkv+f+tki+hPn+++ G++Cl+ilk +kWspal++++
   Q: 8 RIIKETQRLLADPVPGISANPDES-NARYFHVMIAGPDDSPFAGGVFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILK--DKWSPALQIRT 104
    899*********************.9************************************************************9..*********** PP
   S: 101 vllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    vllsiq+ll+ pnpe+pl +++ae++k+n++e k+++
   Q: 105 VLLSIQALLSAPNPEDPLATDVAEQWKTNEAEAIKTAK 142
    *****************************998777765 PP
   

Organism Caenorhabditis elegans
Functional Description
(View)

Functional Description



     Involved in protein ubiquitination, but has no ubiquitin ligase activity on its own (PubMed:15530417). The uev-1-ubc-13 heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains (PubMed:15530417, PubMed:24595290). Involved in sorting Lys-63-linked polyubiquinated maternal membrane proteins for degradation by targeting to multivesicular bodies (PubMed:24595290). May be involved in the ubiquitination and growth of intracellular polyglutamine protein aggregates (PubMed:17663792, PubMed:22494772). May have a role in AMPA-type glutamate receptor trafficking in neurons (PubMed:21179194).
Involved in protein ubiquitination, but has no ubiquitin ligase activity on its own (PubMed:15530417). The uev-1-ubc-13 heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains (PubMed:15530417, PubMed:24595290). Involved in sorting Lys-63-linked polyubiquinated maternal membrane proteins for degradation by targeting to multivesicular bodies (PubMed:24595290). May be involved in the ubiquitination and growth of intracellular polyglutamine protein aggregates (PubMed:17663792, PubMed:22494772). May have a role in AMPA-type glutamate receptor trafficking in neurons (PubMed:21179194).
Protein Sequence
(Fasta)
MAGQLPRRII KETQRLLADP VPGISANPDE SNARYFHVMI AGPDDSPFAG GVFKLELFLP 60
EEYPMAAPKV RFMTKIYHPN IDKLGRICLD ILKDKWSPAL QIRTVLLSIQ ALLSAPNPED 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Cel-018119|E2,E2/UBC|Caenorhabditis elegans
Please wait for a moment...
Nucleotide Sequence
(Fasta)
AATGGCCGGG CAACTTCCGC GTCGAATCAT CAAAGAGACA CAACGACTTC TCGCGGATCC 60
GGTTCCCGGA ATATCGGCAA ATCCAGACGA GAGCAACGCC AGATACTTCC ATGTCATGAT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Cel-018119|E2,E2/UBC|Caenorhabditis elegans
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0436--Ligase
KW-1185--Reference proteome
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005634--C:nucleus
GO:0031371--C:ubiquitin conjugating enzyme complex
GO:0016874--F:ligase activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0006301--P:postreplication repair
GO:0070534--P:protein K63-linked ubiquitination
GO:0016567--P:protein ubiquitination
GO:2000008--P:regulation of protein localization to cell surface

KEGG cel:CELE_Y54G2A.31
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000100 Aegilops tauschii 79.73 8.00e-69 250.00
IUUC-Aml-001889 Ailuropoda melanoleuca 85.92 3.00e-71 259.00
IUUC-Atr-002818 Amborella trichopoda 80.41 8.00e-70 254.00
IUUC-Apl-003469 Anas platyrhynchos 86.62 2.00e-72 262.00
IUUC-Aca-005051 Anolis carolinensis 88.59 3.00e-75 272.00
IUUC-Aly-006258 Arabidopsis lyrata 79.19 8.00e-70 254.00
IUUC-Ath-007639 Arabidopsis thaliana 79.19 2.00e-69 253.00
IUUC-Ago-007837 Ashbya gossypii 76.23 3.00e-53 199.00
IUUC-Acl-008263 Aspergillus clavatus 70.34 1.00e-61 226.00
IUUC-Afl-008733 Aspergillus flavus 69.66 3.00e-61 225.00
IUUC-Afu-008946 Aspergillus fumigatus 70.34 1.00e-61 226.00
IUUC-Ani-009482 Aspergillus nidulans 71.81 2.00e-63 233.00
IUUC-Ang-009678 Aspergillus niger 71.03 1.00e-61 226.00
IUUC-Aor-010025 Aspergillus oryzae 69.66 3.00e-61 225.00
IUUC-Ate-010254 Aspergillus terreus 70.34 9.00e-61 224.00
IUUC-Ame-010742 Astyanax mexicanus 87.92 6.00e-75 271.00
IUUC-Bgr-012156 Blumeria graminis 64.19 4.00e-53 198.00
IUUC-Bta-012636 Bos taurus 88.59 3.00e-75 272.00
IUUC-Bci-013761 Botrytis cinerea 70.07 7.00e-61 224.00
IUUC-Bdi-014796 Brachypodium distachyon 79.19 8.00e-70 254.00
IUUC-Bol-016613 Brassica oleracea 79.19 7.00e-70 254.00
IUUC-Bra-016938 Brassica rapa 79.19 7.00e-70 254.00
IUUC-Cja-019108 Callithrix jacchus 88.59 3.00e-75 272.00
IUUC-Cfa-020561 Canis familiaris 87.92 1.00e-74 270.00
IUUC-Cpo-022280 Cavia porcellus 84.46 6.00e-72 261.00
IUUC-Cre-022978 Chlamydomonas reinhardtii 79.33 7.00e-69 251.00
IUUC-Csa-023860 Chlorocebus sabaeus 81.21 6.00e-68 248.00
IUUC-Cho-024459 Choloepus hoffmanni 88.59 3.00e-75 272.00
IUUC-Cin-025278 Ciona intestinalis 77.40 1.00e-65 240.00
IUUC-Csv-025952 Ciona savignyi 71.03 1.00e-57 213.00
IUUC-Cgl-026752 Colletotrichum gloeosporioides 71.72 6.00e-62 228.00
IUUC-Cne-026809 Cryptococcus neoformans 74.63 1.00e-57 213.00
IUUC-Cme-027100 Cyanidioschyzon merolae 67.33 2.00e-60 223.00
IUUC-Dre-027814 Danio rerio 87.92 6.00e-75 271.00
IUUC-Dno-030059 Dasypus novemcinctus 86.58 2.00e-73 266.00
IUUC-Dor-030269 Dipodomys ordii 90.70 7.00e-68 247.00
IUUC-Dse-031505 Dothistroma septosporum 68.00 2.00e-61 226.00
IUUC-Dme-032097 Drosophila melanogaster 80.27 3.00e-71 258.00
IUUC-Ete-032369 Echinops telfairi 88.59 3.00e-75 272.00
IUUC-Eca-033230 Equus caballus 88.59 3.00e-75 272.00
IUUC-Fca-036161 Felis catus 86.21 2.00e-72 262.00
IUUC-Fal-036781 Ficedula albicollis 85.23 1.00e-72 263.00
IUUC-Fox-037840 Fusarium oxysporum 71.23 1.00e-61 226.00
IUUC-Fso-038118 Fusarium solani 71.92 3.00e-62 229.00
IUUC-Gmo-039561 Gadus morhua 84.67 2.00e-73 266.00
IUUC-Ggr-039807 Gaeumannomyces graminis 71.72 3.00e-62 228.00
IUUC-Gga-041024 Gallus gallus 88.59 3.00e-75 272.00
IUUC-Gac-042450 Gasterosteus aculeatus 85.23 1.00e-72 263.00
IUUC-Gma-043982 Glycine max 79.19 8.00e-70 254.00
IUUC-Ggo-044660 Gorilla gorilla 87.92 1.00e-74 270.00
IUUC-Hsa-045881 Homo sapiens 88.59 3.00e-75 272.00
IUUC-Hvu-047346 Hordeum vulgare 79.19 9.00e-70 253.00
IUUC-Itr-048778 Ictidomys tridecemlineatus 87.50 1.00e-68 250.00
IUUC-Kpa-049285 Komagataella pastoris 70.75 3.00e-62 229.00
IUUC-Lch-050548 Latimeria chalumnae 85.61 4.00e-70 255.00
IUUC-Lpe-051394 Leersia perrieri 79.19 2.00e-69 252.00
IUUC-Loc-052205 Lepisosteus oculatus 87.92 6.00e-75 271.00
IUUC-Lma-053056 Leptosphaeria maculans 71.23 8.00e-62 227.00
IUUC-Laf-053540 Loxodonta africana 88.41 8.00e-71 257.00
IUUC-Mcc-054863 Macaca mulatta 88.59 3.00e-75 272.00
IUUC-Meu-056482 Macropus eugenii 88.41 8.00e-71 257.00
IUUC-Mor-057014 Magnaporthe oryzae 71.72 9.00e-62 227.00
IUUC-Mpo-057586 Magnaporthe poae 71.72 4.00e-62 228.00
IUUC-Mtr-058552 Medicago truncatula 71.17 9.00e-66 241.00
IUUC-Mla-058920 Melampsora laricipopulina 70.86 6.00e-63 231.00
IUUC-Mga-059649 Meleagris gallopavo 84.93 8.00e-72 260.00
IUUC-Mvi-060483 Microbotryum violaceum 75.51 1.00e-65 240.00
IUUC-Mmr-061167 Microcebus murinus 88.59 3.00e-75 272.00
IUUC-Mdo-062701 Monodelphis domestica 88.59 3.00e-75 272.00
IUUC-Mmu-064070 Mus musculus 88.59 3.00e-75 272.00
IUUC-Mac-064742 Musa acuminata 79.87 4.00e-70 255.00
IUUC-Mpu-066401 Mustela putorius furo 88.59 3.00e-75 272.00
IUUC-Mlu-067229 Myotis lucifugus 87.41 3.00e-72 262.00
IUUC-Nfi-068526 Neosartorya fischeri 70.34 2.00e-61 226.00
IUUC-Ncr-068643 Neurospora crassa 71.03 1.00e-61 226.00
IUUC-Nle-070146 Nomascus leucogenys 88.59 3.00e-75 272.00
IUUC-Opr-070232 Ochotona princeps 69.80 1.00e-53 200.00
IUUC-Ont-072369 Oreochromis niloticus 87.25 2.00e-74 269.00
IUUC-Oan-073174 Ornithorhynchus anatinus 86.81 2.00e-72 262.00
IUUC-Ocu-074712 Oryctolagus cuniculus 88.59 3.00e-75 272.00
IUUC-Oba-075408 Oryza barthii 79.19 2.00e-69 252.00
IUUC-Obr-076881 Oryza brachyantha 79.19 2.00e-69 252.00
IUUC-Ogl-077242 Oryza glaberrima 79.19 2.00e-69 252.00
IUUC-Ogu-078465 Oryza glumaepatula 79.19 2.00e-69 252.00
IUUC-Oin-080035 Oryza indica 79.29 3.00e-65 238.00
IUUC-Olo-080555 Oryza longistaminata 79.19 2.00e-69 252.00
IUUC-Ome-081653 Oryza meridionalis 79.19 2.00e-69 252.00
IUUC-Oni-082400 Oryza nivara 79.19 2.00e-69 252.00
IUUC-Opu-083130 Oryza punctata 81.16 2.00e-65 240.00
IUUC-Oru-084649 Oryza rufipogon 79.19 2.00e-69 252.00
IUUC-Osa-085629 Oryza sativa 79.19 2.00e-69 252.00
IUUC-Ola-087083 Oryzias latipes 87.92 2.00e-74 269.00
IUUC-Olu-087886 Ostreococcus lucimarinus 63.76 7.00e-57 211.00
IUUC-Oga-088983 Otolemur garnettii 84.83 2.00e-71 259.00
IUUC-Oar-090440 Ovis aries 87.92 1.00e-74 270.00
IUUC-Ptr-090572 Pan troglodytes 88.59 3.00e-75 272.00
IUUC-Pan-092503 Papio anubis 86.58 1.00e-73 266.00
IUUC-Psi-093419 Pelodiscus sinensis 87.88 3.00e-67 245.00
IUUC-Pma-094136 Petromyzon marinus 80.85 6.00e-41 157.00
IUUC-Pno-094838 Phaeosphaeria nodorum 70.20 7.00e-62 228.00
IUUC-Ppa-096014 Physcomitrella patens 79.73 8.00e-70 254.00
IUUC-Pfo-096074 Poecilia formosa 87.92 9.00e-75 270.00
IUUC-Pab-097778 Pongo abelii 88.59 3.00e-75 272.00
IUUC-Pop-099707 Populus trichocarpa 79.19 1.00e-69 253.00
IUUC-Pca-100334 Procavia capensis 75.17 4.00e-63 231.00
IUUC-Ppe-101149 Prunus persica 79.19 8.00e-70 254.00
IUUC-Pva-102979 Pteropus vampyrus 88.59 3.00e-75 272.00
IUUC-Pgr-103654 Puccinia graminis 70.67 4.00e-62 228.00
IUUC-Ptt-103752 Puccinia triticina 69.66 4.00e-59 218.00
IUUC-Pte-104137 Pyrenophora teres 70.55 2.00e-61 226.00
IUUC-Pyt-104513 Pyrenophora triticirepentis 70.55 2.00e-61 226.00
IUUC-Rno-105927 Rattus norvegicus 87.92 5.00e-75 271.00
IUUC-Sce-106178 Saccharomyces cerevisiae 66.89 7.00e-59 218.00
IUUC-Sha-107493 Sarcophilus harrisii 88.59 3.00e-75 272.00
IUUC-Sja-107878 Schizosaccharomyces japonicus 65.99 4.00e-55 205.00
IUUC-Spo-108062 Schizosaccharomyces pombe 65.52 6.00e-54 201.00
IUUC-Ssl-108395 Sclerotinia sclerotiorum 70.07 1.00e-60 223.00
IUUC-Smo-109587 Selaginella moellendorffii 74.50 3.00e-63 232.00
IUUC-Sit-110151 Setaria italica 79.19 2.00e-69 253.00
IUUC-Sly-111322 Solanum lycopersicum 79.19 7.00e-70 254.00
IUUC-Stu-112254 Solanum tuberosum 78.52 2.00e-69 253.00
IUUC-Sar-113464 Sorex araneus 88.41 8.00e-71 257.00
IUUC-Sbi-114864 Sorghum bicolor 79.87 2.00e-69 253.00
IUUC-Sre-114927 Sporisorium reilianum 77.40 3.00e-66 242.00
IUUC-Ssc-116096 Sus scrofa 88.59 3.00e-75 272.00
IUUC-Tgu-117266 Taeniopygia guttata 88.41 8.00e-71 257.00
IUUC-Tru-117903 Takifugu rubripes 85.91 1.00e-73 266.00
IUUC-Tsy-118952 Tarsius syrichta 88.41 8.00e-71 257.00
IUUC-Tni-120038 Tetraodon nigroviridis 85.91 1.00e-73 266.00
IUUC-Tca-121752 Theobroma cacao 77.18 3.00e-66 243.00
IUUC-Tre-121979 Trichoderma reesei 71.23 7.00e-62 227.00
IUUC-Tvi-122515 Trichoderma virens 70.75 1.00e-61 226.00
IUUC-Tae-124984 Triticum aestivum 79.19 6.00e-70 254.00
IUUC-Tur-126865 Triticum urartu 80.58 4.00e-65 238.00
IUUC-Tme-127129 Tuber melanosporum 70.75 2.00e-62 229.00
IUUC-Tbe-127846 Tupaia belangeri 88.41 8.00e-71 257.00
IUUC-Ttr-128808 Tursiops truncatus 86.21 6.00e-72 261.00
IUUC-Uma-129548 Ustilago maydis 75.51 2.00e-65 239.00
IUUC-Vda-129810 Verticillium dahliae 69.59 6.00e-62 228.00
IUUC-Vpa-130221 Vicugna pacos 82.14 3.00e-62 228.00
IUUC-Vvi-131158 Vitis vinifera 80.58 3.00e-65 239.00
IUUC-Xtr-132366 Xenopus tropicalis 86.09 5.00e-73 264.00
IUUC-Xma-132986 Xiphophorus maculatus 87.25 3.00e-74 268.00
IUUC-Yli-134605 Yarrowia lipolytica 70.75 2.00e-61 226.00
IUUC-Zma-135587 Zea mays 75.48 4.00e-67 245.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved