• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • CPLM
    • dbPAF
    • dbPTM
    • UniProt
    • PHOSIDA
    • BioGRID
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
UUCD2 ID IUUC-Cel-018653
UUCD1 version UUC-CaE-00067
Ensembl Protein ID F46A9.5.1
UniProt Accession G5ECU1; Q8WSZ9; SKR1_CAEEL
Genbank Protein ID CAB03110.1; AAL34093.1
Protein Name Skp1-related protein
Genbank Nucleotide ID BX284601; AF440505
Gene Name skr-1; F46A9.5
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
WBGene00004807 F46A9.5.1 F46A9.5.1
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEO
DNA & RNA Element
microRNARAID2
Protein-protein Interaction
IIDiRefIndexPINAMentha
Post-translational Modifications (PTMs)
dbPAFPHOSIDA
Protein Expression/Proteomics
GPMDB
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 2.30e-31 108.0 127 174
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 1    ksLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    k+LLd+tcktVa+mikgk+peeiR+tFni+nDftpeEe+++R+En+W+
   Q: 127 KGLLDVTCKTVANMIKGKSPEEIRRTFNIKNDFTPEEEEQIRKENAWC 174
    89*********************************************8 PP
   

Organism Caenorhabditis elegans
Functional Description
(View)

Functional Description



     Probable essential component of SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:17626846). Regulates cell proliferation during embryonic and larval development (PubMed:11864567, PubMed:11864566). Involved in synapse elimination in early synapse development (PubMed:17626846). May negatively regulate the apoptotic activity of cep-1 in response to genotoxic stress (PubMed:18340346). Plays a role in sex determination (PubMed:18718460).
Probable essential component of SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:17626846). Regulates cell proliferation during embryonic and larval development (PubMed:11864567, PubMed:11864566). Involved in synapse elimination in early synapse development (PubMed:17626846). May negatively regulate the apoptotic activity of cep-1 in response to genotoxic stress (PubMed:18340346). Plays a role in sex determination (PubMed:18718460).
Protein Sequence
(Fasta)
MADQKKVSEA AKEREIKISS SDNEIFLVPR NVIRLSNTIN TLLMDLGLDD EEGTNAEPIP 60
VQNVTASILK KVISWCNHHH SDPISTEDSD NREKRTDDIG SWDVEFLKVD QGTLFELILA 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Cel-018653|E3,SKP1|Caenorhabditis elegans
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ACACACTCAC ATTCTATTCG CTCATTTCTC AACGTTCTCA TTCTATTTTT CGTTGTTTTT 60
CTTTGTTTTG CAGGTATTTT GCGTTGGAAA ATTTAAAACT TTTAATTTTT CTCGATGGAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Cel-018653|E3,SKP1|Caenorhabditis elegans
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0217--Developmental protein
KW-0524--Neurogenesis
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0046660--P:female sex differentiation
GO:0010826--P:negative regulation of centrosome duplication
GO:0043518--P:negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0010629--P:negative regulation of gene expression
GO:1902230--P:negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0007399--P:nervous system development
GO:0043065--P:positive regulation of apoptotic process
GO:0031647--P:regulation of protein stability
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG cel:CELE_F46A9.5
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001036 Aegilops tauschii 51.19 2.00e-43 166.00
IUUC-Aml-002023 Ailuropoda melanoleuca 67.70 1.00e-51 194.00
IUUC-Atr-002858 Amborella trichopoda 53.42 4.00e-35 139.00
IUUC-Apl-003393 Anas platyrhynchos 67.70 1.00e-51 194.00
IUUC-Aca-004709 Anolis carolinensis 67.70 1.00e-51 194.00
IUUC-Aly-006066 Arabidopsis lyrata 51.48 8.00e-36 141.00
IUUC-Ath-007456 Arabidopsis thaliana 51.53 3.00e-39 152.00
IUUC-Ago-007847 Ashbya gossypii 58.47 2.00e-37 147.00
IUUC-Acl-008178 Aspergillus clavatus 58.39 3.00e-50 189.00
IUUC-Afl-008452 Aspergillus flavus 60.25 2.00e-52 196.00
IUUC-Afu-008785 Aspergillus fumigatus 59.01 3.00e-50 189.00
IUUC-Ani-009312 Aspergillus nidulans 56.71 1.00e-46 177.00
IUUC-Aor-010012 Aspergillus oryzae 60.25 2.00e-52 196.00
IUUC-Ate-010375 Aspergillus terreus 59.75 1.00e-50 190.00
IUUC-Ame-011025 Astyanax mexicanus 67.08 2.00e-51 193.00
IUUC-Bgr-012280 Blumeria graminis 50.68 9.00e-32 127.00
IUUC-Bta-013519 Bos taurus 67.70 1.00e-51 194.00
IUUC-Bci-013888 Botrytis cinerea 58.06 2.00e-33 133.00
IUUC-Bdi-014547 Brachypodium distachyon 49.10 7.00e-34 134.00
IUUC-Bol-015842 Brassica oleracea 54.04 2.00e-37 146.00
IUUC-Bra-017558 Brassica rapa 48.78 3.00e-37 145.00
IUUC-Cja-019823 Callithrix jacchus 64.60 3.00e-47 179.00
IUUC-Cfa-020931 Canis familiaris 67.70 1.00e-51 193.00
IUUC-Cpo-022487 Cavia porcellus 67.08 2.00e-49 186.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 53.70 5.00e-39 152.00
IUUC-Csa-023459 Chlorocebus sabaeus 67.08 2.00e-51 192.00
IUUC-Cho-024854 Choloepus hoffmanni 66.22 2.00e-18 82.80
IUUC-Cin-025538 Ciona intestinalis 65.22 1.00e-47 180.00
IUUC-Csv-025865 Ciona savignyi 64.60 6.00e-52 194.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 52.98 5.00e-41 158.00
IUUC-Cne-027058 Cryptococcus neoformans 55.29 7.00e-51 191.00
IUUC-Cme-027174 Cyanidioschyzon merolae 46.30 1.00e-36 144.00
IUUC-Dre-027756 Danio rerio 67.08 2.00e-51 193.00
IUUC-Dno-028924 Dasypus novemcinctus 67.70 1.00e-51 194.00
IUUC-Dor-030847 Dipodomys ordii 63.98 3.00e-49 186.00
IUUC-Dse-031209 Dothistroma septosporum 55.56 7.00e-47 178.00
IUUC-Dme-032028 Drosophila melanogaster 63.35 8.00e-58 214.00
IUUC-Ete-033117 Echinops telfairi 65.84 3.00e-48 182.00
IUUC-Eca-033320 Equus caballus 67.70 1.00e-51 194.00
IUUC-Eeu-034817 Erinaceus europaeus 89.36 2.00e-20 88.20
IUUC-Fca-035423 Felis catus 67.70 1.00e-51 194.00
IUUC-Fal-036956 Ficedula albicollis 67.70 1.00e-51 194.00
IUUC-Fox-037761 Fusarium oxysporum 54.78 3.00e-44 169.00
IUUC-Fso-038451 Fusarium solani 53.95 6.00e-41 158.00
IUUC-Gmo-039178 Gadus morhua 67.70 9.00e-52 194.00
IUUC-Ggr-039831 Gaeumannomyces graminis 56.00 2.00e-42 163.00
IUUC-Gga-040238 Gallus gallus 67.70 1.00e-51 194.00
IUUC-Gac-041965 Gasterosteus aculeatus 67.70 9.00e-52 194.00
IUUC-Gma-042996 Glycine max 53.42 1.00e-34 137.00
IUUC-Ggo-045025 Gorilla gorilla 67.70 1.00e-51 194.00
IUUC-Hsa-046875 Homo sapiens 67.70 1.00e-51 194.00
IUUC-Hvu-047497 Hordeum vulgare 50.59 5.00e-38 148.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 65.84 6.00e-50 188.00
IUUC-Kpa-049138 Komagataella pastoris 45.70 2.00e-37 147.00
IUUC-Lch-050522 Latimeria chalumnae 71.34 7.00e-57 211.00
IUUC-Lpe-051398 Leersia perrieri 49.39 6.00e-38 149.00
IUUC-Loc-052596 Lepisosteus oculatus 67.70 9.00e-52 194.00
IUUC-Lma-053020 Leptosphaeria maculans 53.95 1.00e-39 154.00
IUUC-Laf-053847 Loxodonta africana 67.70 1.00e-51 194.00
IUUC-Mor-057176 Magnaporthe oryzae 55.03 6.00e-43 165.00
IUUC-Mpo-057471 Magnaporthe poae 56.00 2.00e-42 163.00
IUUC-Mtr-058458 Medicago truncatula 51.88 3.00e-42 162.00
IUUC-Mla-059153 Melampsora laricipopulina 56.52 6.00e-44 168.00
IUUC-Mga-059864 Meleagris gallopavo 67.70 1.00e-51 194.00
IUUC-Mvi-060342 Microbotryum violaceum 57.32 1.00e-47 180.00
IUUC-Mdo-062509 Monodelphis domestica 67.70 1.00e-51 194.00
IUUC-Mmu-063694 Mus musculus 67.70 9.00e-52 194.00
IUUC-Mac-064537 Musa acuminata 53.42 4.00e-34 135.00
IUUC-Mpu-065990 Mustela putorius furo 67.70 1.00e-51 194.00
IUUC-Mlu-068168 Myotis lucifugus 67.70 1.00e-51 194.00
IUUC-Nfi-068309 Neosartorya fischeri 59.01 3.00e-50 189.00
IUUC-Ncr-068658 Neurospora crassa 53.69 2.00e-41 159.00
IUUC-Nle-070101 Nomascus leucogenys 67.70 1.00e-51 194.00
IUUC-Opr-070881 Ochotona princeps 67.70 1.00e-51 194.00
IUUC-Ont-071529 Oreochromis niloticus 67.70 9.00e-52 194.00
IUUC-Oan-073000 Ornithorhynchus anatinus 87.72 7.00e-27 110.00
IUUC-Ocu-073780 Oryctolagus cuniculus 67.70 1.00e-51 194.00
IUUC-Oba-075368 Oryza barthii 46.33 3.00e-34 135.00
IUUC-Obr-076526 Oryza brachyantha 52.66 7.00e-36 141.00
IUUC-Ogl-077679 Oryza glaberrima 46.33 4.00e-34 135.00
IUUC-Ogu-078125 Oryza glumaepatula 46.89 3.00e-34 136.00
IUUC-Oin-079779 Oryza indica 46.33 2.00e-34 136.00
IUUC-Olo-080736 Oryza longistaminata 43.11 4.00e-32 129.00
IUUC-Ome-081330 Oryza meridionalis 47.16 2.00e-34 136.00
IUUC-Oni-082143 Oryza nivara 46.33 2.00e-34 136.00
IUUC-Opu-083354 Oryza punctata 48.02 4.00e-32 129.00
IUUC-Oru-084246 Oryza rufipogon 47.46 5.00e-31 125.00
IUUC-Osa-085416 Oryza sativa 46.33 2.00e-34 136.00
IUUC-Ola-087270 Oryzias latipes 67.70 9.00e-52 194.00
IUUC-Olu-087667 Ostreococcus lucimarinus 51.55 5.00e-42 161.00
IUUC-Oga-089073 Otolemur garnettii 67.70 1.00e-51 194.00
IUUC-Oar-089762 Ovis aries 58.01 7.00e-43 165.00
IUUC-Ptr-090872 Pan troglodytes 63.98 5.00e-49 185.00
IUUC-Pan-091780 Papio anubis 67.70 1.00e-51 194.00
IUUC-Psi-093135 Pelodiscus sinensis 67.70 1.00e-51 194.00
IUUC-Pno-094810 Phaeosphaeria nodorum 52.90 3.00e-38 149.00
IUUC-Ppa-095244 Physcomitrella patens 52.47 3.00e-39 152.00
IUUC-Pfo-097529 Poecilia formosa 67.70 9.00e-52 194.00
IUUC-Pab-098533 Pongo abelii 67.70 1.00e-51 194.00
IUUC-Pop-098957 Populus trichocarpa 55.28 4.00e-39 152.00
IUUC-Pca-100783 Procavia capensis 58.39 1.00e-40 157.00
IUUC-Ppe-101463 Prunus persica 54.38 5.00e-44 168.00
IUUC-Pva-102901 Pteropus vampyrus 67.70 1.00e-51 194.00
IUUC-Pgr-103499 Puccinia graminis 54.94 4.00e-44 168.00
IUUC-Ptt-103874 Puccinia triticina 66.94 8.00e-45 172.00
IUUC-Pte-104224 Pyrenophora teres 52.35 1.00e-34 137.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 52.26 2.00e-36 143.00
IUUC-Rno-105499 Rattus norvegicus 67.70 7.00e-52 194.00
IUUC-Sce-106387 Saccharomyces cerevisiae 60.17 6.00e-37 145.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 55.21 8.00e-46 174.00
IUUC-Spo-108033 Schizosaccharomyces pombe 57.06 4.00e-47 179.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 55.78 7.00e-41 158.00
IUUC-Smo-109307 Selaginella moellendorffii 51.88 1.00e-37 147.00
IUUC-Sit-110435 Setaria italica 48.54 1.00e-35 140.00
IUUC-Sly-111529 Solanum lycopersicum 53.99 2.00e-37 147.00
IUUC-Stu-112023 Solanum tuberosum 55.70 9.00e-37 144.00
IUUC-Sar-112973 Sorex araneus 65.22 2.00e-44 170.00
IUUC-Sbi-114394 Sorghum bicolor 50.00 3.00e-38 149.00
IUUC-Sre-115178 Sporisorium reilianum 56.17 1.00e-49 187.00
IUUC-Tgu-116474 Taeniopygia guttata 67.70 1.00e-51 194.00
IUUC-Tru-118429 Takifugu rubripes 67.70 9.00e-52 194.00
IUUC-Tsy-118896 Tarsius syrichta 67.70 1.00e-51 194.00
IUUC-Tni-119960 Tetraodon nigroviridis 67.70 9.00e-52 194.00
IUUC-Tca-121022 Theobroma cacao 55.56 1.00e-37 147.00
IUUC-Tre-122004 Trichoderma reesei 53.29 1.00e-35 140.00
IUUC-Tvi-122449 Trichoderma virens 51.85 8.00e-36 141.00
IUUC-Tae-125854 Triticum aestivum 51.19 2.00e-43 166.00
IUUC-Tur-126793 Triticum urartu 50.90 3.00e-41 159.00
IUUC-Tme-127078 Tuber melanosporum 57.67 2.00e-42 163.00
IUUC-Tbe-127720 Tupaia belangeri 67.70 1.00e-51 194.00
IUUC-Ttr-129035 Tursiops truncatus 67.70 1.00e-51 194.00
IUUC-Uma-129517 Ustilago maydis 54.94 3.00e-48 182.00
IUUC-Vda-129691 Verticillium dahliae 57.24 2.00e-37 146.00
IUUC-Vpa-130128 Vicugna pacos 68.32 1.00e-51 194.00
IUUC-Vvi-130876 Vitis vinifera 52.76 4.00e-43 165.00
IUUC-Xtr-132393 Xenopus tropicalis 67.70 1.00e-51 194.00
IUUC-Xma-133603 Xiphophorus maculatus 67.70 9.00e-52 194.00
IUUC-Yli-134499 Yarrowia lipolytica 55.42 4.00e-44 169.00
IUUC-Zma-135354 Zea mays 50.00 7.00e-36 141.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved