• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
  • PTM
    • dbPAF
    • PHOSIDA
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Cel-018231
UUCD1 version UUC-CaE-00046
Ensembl Protein ID W10D5.3c.1
UniProt Accession Q94361; Q564X2; Q7Z0X3; Q7Z0X4; Q94363; Q9U326; GEI17_CAEEL
Genbank Protein ID CAB02133.4; CAB02134.3; CAB54321.3; CAD98729.3; CAD98730.3; CAI79179.3
Protein Name E3 SUMO-protein ligase gei-17; Gex-3-interacting protein 17
Genbank Nucleotide ID Z79758; Z79758; Z79758; Z79758; Z79758; Z79758
Gene Name gei-17; W10D5.3
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
WBGene00001574 W10D5.3a.1 W10D5.3a.1
WBGene00001574 W10D5.3c.1 W10D5.3c.1
WBGene00001574 W10D5.3d W10D5.3d
WBGene00001574 W10D5.3e.1 W10D5.3e.1
WBGene00001574 W10D5.3f.1 W10D5.3f.1
WBGene00001574 W10D5.3g.1 W10D5.3g.1
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEO
DNA & RNA Element
microRNARAID2
Protein-protein Interaction
IIDiRefIndexPINAMentha
Post-translational Modifications (PTMs)
dbPAFPHOSIDA
Protein Expression/Proteomics
GPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
E3 activity/RING/RING RING 19111656
Classification
Family E-value Score Start End
E3 activity/RING/RING 0.00017 22.3 416 457
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/RING/RING

   S: 2    aiCledfkdgplvlpCgHvfhadClqkwpglknssskefrCPlC 45
    ++C++++ ++ ++ +C H+ ++d l + +++n+++++++CP+C
   Q: 416 PLCKTRMTTPSRCQDCTHLQCFDLL-SY-LMMNEKKPTWQCPVC 457
    79*******9999999999999998.44.689************ PP
   

Organism Caenorhabditis elegans
Functional Description
(View)

Functional Description



     Functions as an E3-type smo-1 ligase (PubMed:15654100, PubMed:16701625, PubMed:16549501, PubMed:25475837). Mediates smo-1 conjugation to air-2 in vitro and is required for proper chromosome alignment (PubMed:25475837). In the early embryo, specifically suppresses checkpoint activation in response to DNA damage, maybe by promoting mus-101 sumoylation (PubMed:15654100).
Functions as an E3-type smo-1 ligase (PubMed:15654100, PubMed:16701625, PubMed:16549501, PubMed:25475837). Mediates smo-1 conjugation to air-2 in vitro and is required for proper chromosome alignment (PubMed:25475837). In the early embryo, specifically suppresses checkpoint activation in response to DNA damage, maybe by promoting mus-101 sumoylation (PubMed:15654100).
Protein Sequence
(Fasta)
MLPNNQWQIP INNGLTHQEN MAAHAAVMKL RVHDLQSIIS QLSLRKPRPQ KSEHQKVVVE 60
SLRDPHHARQ IYQMASNFPN GNYEMQKRPA TTSQVRSHPY VLPSRSGASN HLVNHHYQQQ 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Cel-018231|E3,RING|Caenorhabditis elegans
Please wait for a moment...
Nucleotide Sequence
(Fasta)
AAAACACAAA TTTTCTGGCG CCTCTTCTGA AAATTGCTGA TCCTTTGTCA CGGGCACAAA 60
CCTATCGTAC ACATTGATCT CATTGATTTC CTGAATGAGT TAACGTGAGT ACGTTGAAAT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Cel-018231|E3,RING|Caenorhabditis elegans
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0025--Alternative splicing
KW-0181--Complete proteome
KW-0227--DNA damage
KW-0234--DNA repair
KW-0436--Ligase
KW-0479--Metal-binding
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway
KW-0862--Zinc
KW-0863--Zinc-finger

Interpro

IPR023321--PINIT
IPR027229--SIZ1/SIZ2/Pli1/Gei17
IPR004181--Znf_MIZ
IPR013083--Znf_RING/FYVE/PHD

PROSITE

PS51466--PINIT
PS51044--ZF_SP_RING

Pfam

PF14324--PINIT
PF02891--zf-MIZ

Gene Ontology

GO:0070090--C:metaphase plate
GO:0000790--C:nuclear chromatin
GO:0016874--F:ligase activity
GO:0001085--F:RNA polymerase II transcription factor binding
GO:0061665--F:SUMO ligase activity
GO:0008270--F:zinc ion binding
GO:0006974--P:cellular response to DNA damage stimulus
GO:0006281--P:DNA repair
GO:0009792--P:embryo development ending in birth or egg hatching
GO:0043060--P:meiotic metaphase I plate congression
GO:1903363--P:negative regulation of cellular protein catabolic process
GO:1904290--P:negative regulation of mitotic DNA damage checkpoint
GO:1904333--P:positive regulation of error-prone translesion synthesis
GO:1990466--P:protein autosumoylation
GO:0016925--P:protein sumoylation

KEGG cel:CELE_W10D5.3
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000547 Aegilops tauschii 24.52 2.00e-15 76.30
IUUC-Aml-001984 Ailuropoda melanoleuca 37.26 3.00e-50 191.00
IUUC-Atr-002963 Amborella trichopoda 26.11 5.00e-16 78.60
IUUC-Apl-003376 Anas platyrhynchos 36.94 4.00e-50 191.00
IUUC-Aca-004444 Anolis carolinensis 35.80 3.00e-48 185.00
IUUC-Aly-005490 Arabidopsis lyrata 30.00 1.00e-15 77.40
IUUC-Ath-007617 Arabidopsis thaliana 34.02 4.00e-15 75.50
IUUC-Ago-007762 Ashbya gossypii 28.84 3.00e-17 82.80
IUUC-Acl-008204 Aspergillus clavatus 31.25 2.00e-17 82.40
IUUC-Afl-008672 Aspergillus flavus 29.82 4.00e-18 84.70
IUUC-Afu-008758 Aspergillus fumigatus 32.12 4.00e-20 91.30
IUUC-Ani-009389 Aspergillus nidulans 30.90 6.00e-19 87.40
IUUC-Ang-009590 Aspergillus niger 30.39 1.00e-17 83.60
IUUC-Aor-009912 Aspergillus oryzae 34.86 2.00e-17 82.40
IUUC-Ate-010496 Aspergillus terreus 30.68 4.00e-18 84.70
IUUC-Ame-011812 Astyanax mexicanus 37.72 9.00e-42 163.00
IUUC-Bgr-012177 Blumeria graminis 36.46 1.00e-14 73.60
IUUC-Bta-012457 Bos taurus 37.26 2.00e-50 192.00
IUUC-Bci-013700 Botrytis cinerea 29.78 2.00e-19 89.00
IUUC-Bdi-014629 Brachypodium distachyon 23.08 2.00e-16 79.70
IUUC-Bol-015250 Brassica oleracea 35.78 2.00e-17 83.20
IUUC-Bra-017443 Brassica rapa 30.06 9.00e-17 80.90
IUUC-Cja-019111 Callithrix jacchus 34.47 5.00e-46 177.00
IUUC-Cfa-020481 Canis familiaris 37.26 3.00e-50 192.00
IUUC-Cpo-021940 Cavia porcellus 37.58 5.00e-51 194.00
IUUC-Csa-023964 Chlorocebus sabaeus 36.94 6.00e-50 191.00
IUUC-Cho-024812 Choloepus hoffmanni 35.00 6.00e-37 147.00
IUUC-Cin-025791 Ciona intestinalis 31.54 2.00e-36 146.00
IUUC-Csv-026329 Ciona savignyi 31.10 3.00e-33 135.00
IUUC-Cgl-026533 Colletotrichum gloeosporioides 32.18 1.00e-21 96.30
IUUC-Cne-026824 Cryptococcus neoformans 38.83 1.00e-18 87.00
IUUC-Cme-027209 Cyanidioschyzon merolae 30.99 1.00e-14 73.90
IUUC-Dre-027526 Danio rerio 37.63 2.00e-43 169.00
IUUC-Dno-029550 Dasypus novemcinctus 37.26 3.00e-50 191.00
IUUC-Dor-030842 Dipodomys ordii 33.33 5.00e-45 174.00
IUUC-Dse-031254 Dothistroma septosporum 25.61 1.00e-26 113.00
IUUC-Dme-032018 Drosophila melanogaster 38.38 7.00e-46 177.00
IUUC-Ete-032366 Echinops telfairi 34.57 9.00e-35 140.00
IUUC-Eca-033639 Equus caballus 37.42 6.00e-50 191.00
IUUC-Eeu-034994 Erinaceus europaeus 36.59 3.00e-44 171.00
IUUC-Fca-035986 Felis catus 36.36 3.00e-50 191.00
IUUC-Fal-036926 Ficedula albicollis 37.26 9.00e-51 193.00
IUUC-Fox-038010 Fusarium oxysporum 25.89 2.00e-14 72.00
IUUC-Fso-038103 Fusarium solani 32.93 2.00e-21 95.10
IUUC-Gmo-039058 Gadus morhua 36.69 3.00e-45 175.00
IUUC-Ggr-039896 Gaeumannomyces graminis 29.65 4.00e-22 98.20
IUUC-Gga-040755 Gallus gallus 36.94 4.00e-50 191.00
IUUC-Gac-042204 Gasterosteus aculeatus 38.79 3.00e-48 185.00
IUUC-Gma-043279 Glycine max 35.00 2.00e-16 80.50
IUUC-Ggo-044494 Gorilla gorilla 35.96 3.00e-47 181.00
IUUC-Hsa-046146 Homo sapiens 36.94 6.00e-50 191.00
IUUC-Hvu-047523 Hordeum vulgare 24.52 7.00e-15 74.70
IUUC-Itr-048994 Ictidomys tridecemlineatus 37.26 2.00e-50 192.00
IUUC-Kpa-049203 Komagataella pastoris 27.12 1.00e-15 77.40
IUUC-Lch-049611 Latimeria chalumnae 39.50 2.00e-49 189.00
IUUC-Lpe-051467 Leersia perrieri 27.33 1.00e-16 80.50
IUUC-Loc-052851 Lepisosteus oculatus 37.59 1.00e-39 156.00
IUUC-Lma-053196 Leptosphaeria maculans 29.86 2.00e-21 95.90
IUUC-Laf-053486 Loxodonta africana 36.31 1.00e-46 179.00
IUUC-Mcc-055123 Macaca mulatta 36.94 6.00e-50 191.00
IUUC-Meu-055949 Macropus eugenii 36.75 5.00e-45 174.00
IUUC-Mor-057185 Magnaporthe oryzae 29.63 1.00e-18 85.90
IUUC-Mpo-057405 Magnaporthe poae 27.76 9.00e-20 90.50
IUUC-Mtr-058267 Medicago truncatula 36.00 2.00e-17 83.60
IUUC-Mla-058882 Melampsora laricipopulina 31.06 3.00e-19 88.60
IUUC-Mga-059790 Meleagris gallopavo 36.94 6.00e-50 190.00
IUUC-Mvi-060421 Microbotryum violaceum 29.65 9.00e-21 94.40
IUUC-Mmr-060785 Microcebus murinus 37.26 4.00e-50 191.00
IUUC-Mdo-061916 Monodelphis domestica 37.38 2.00e-50 192.00
IUUC-Mmu-063170 Mus musculus 37.26 1.00e-50 193.00
IUUC-Mac-064545 Musa acuminata 24.92 9.00e-17 81.30
IUUC-Mpu-066609 Mustela putorius furo 37.26 3.00e-50 192.00
IUUC-Mlu-067164 Myotis lucifugus 36.74 6.00e-50 191.00
IUUC-Nfi-068586 Neosartorya fischeri 34.44 3.00e-20 92.00
IUUC-Ncr-068929 Neurospora crassa 25.00 8.00e-19 87.00
IUUC-Nle-070004 Nomascus leucogenys 36.94 6.00e-50 191.00
IUUC-Opr-070251 Ochotona princeps 37.44 1.00e-30 126.00
IUUC-Ont-071607 Oreochromis niloticus 38.08 9.00e-48 183.00
IUUC-Oan-073567 Ornithorhynchus anatinus 39.50 4.00e-50 191.00
IUUC-Ocu-073833 Oryctolagus cuniculus 37.58 2.00e-51 196.00
IUUC-Oba-075546 Oryza barthii 31.96 9.00e-15 74.30
IUUC-Obr-076593 Oryza brachyantha 25.77 4.00e-14 72.40
IUUC-Ogl-077087 Oryza glaberrima 23.40 2.00e-15 76.30
IUUC-Ogu-078528 Oryza glumaepatula 31.96 1.00e-14 74.30
IUUC-Oin-079884 Oryza indica 23.40 2.00e-15 76.60
IUUC-Olo-080851 Oryza longistaminata 31.96 1.00e-14 74.30
IUUC-Ome-081939 Oryza meridionalis 22.98 4.00e-15 75.90
IUUC-Oni-082285 Oryza nivara 24.82 9.00e-16 77.80
IUUC-Opu-083470 Oryza punctata 22.18 3.00e-15 75.90
IUUC-Oru-085046 Oryza rufipogon 23.40 2.00e-15 76.30
IUUC-Osa-085524 Oryza sativa 23.40 2.00e-15 76.60
IUUC-Ola-086471 Oryzias latipes 38.08 3.00e-48 185.00
IUUC-Olu-087742 Ostreococcus lucimarinus 23.78 2.00e-06 45.80
IUUC-Oga-088527 Otolemur garnettii 37.26 3.00e-50 192.00
IUUC-Oar-089470 Ovis aries 37.06 2.00e-50 192.00
IUUC-Ptr-091086 Pan troglodytes 36.94 6.00e-50 191.00
IUUC-Pan-092236 Papio anubis 36.94 6.00e-50 191.00
IUUC-Psi-093900 Pelodiscus sinensis 37.90 3.00e-51 195.00
IUUC-Pma-094693 Petromyzon marinus 37.80 1.00e-50 192.00
IUUC-Pno-094862 Phaeosphaeria nodorum 31.20 3.00e-23 101.00
IUUC-Ppa-095695 Physcomitrella patens 36.84 2.00e-16 80.10
IUUC-Pfo-096236 Poecilia formosa 35.45 1.00e-48 186.00
IUUC-Pab-098400 Pongo abelii 36.94 8.00e-50 190.00
IUUC-Pop-099745 Populus trichocarpa 23.31 5.00e-16 78.60
IUUC-Pca-100372 Procavia capensis 34.28 2.00e-41 161.00
IUUC-Ppe-101666 Prunus persica 26.17 3.00e-16 79.30
IUUC-Pva-103134 Pteropus vampyrus 36.59 1.00e-46 180.00
IUUC-Pgr-103580 Puccinia graminis 32.87 6.00e-19 87.80
IUUC-Ptt-103870 Puccinia triticina 34.97 1.00e-20 92.40
IUUC-Pte-104331 Pyrenophora teres 30.94 1.00e-21 96.70
IUUC-Pyt-104673 Pyrenophora triticirepentis 33.70 6.00e-22 97.40
IUUC-Rno-105980 Rattus norvegicus 37.26 9.00e-51 193.00
IUUC-Sce-106333 Saccharomyces cerevisiae 26.81 5.00e-19 89.00
IUUC-Sha-107250 Sarcophilus harrisii 36.52 2.00e-46 179.00
IUUC-Sja-107662 Schizosaccharomyces japonicus 26.91 2.00e-24 106.00
IUUC-Spo-108339 Schizosaccharomyces pombe 26.01 9.00e-18 84.00
IUUC-Ssl-108401 Sclerotinia sclerotiorum 29.84 1.00e-10 61.20
IUUC-Smo-109174 Selaginella moellendorffii 34.83 1.00e-12 67.00
IUUC-Sit-110164 Setaria italica 29.41 2.00e-13 70.50
IUUC-Sly-111822 Solanum lycopersicum 28.21 9.00e-16 77.80
IUUC-Stu-112120 Solanum tuberosum 32.63 5.00e-15 74.70
IUUC-Sar-113126 Sorex araneus 37.26 3.00e-50 192.00
IUUC-Sbi-114542 Sorghum bicolor 24.83 2.00e-15 76.30
IUUC-Sre-115069 Sporisorium reilianum 27.52 4.00e-18 85.50
IUUC-Ssc-115394 Sus scrofa 36.74 1.00e-48 186.00
IUUC-Tgu-117164 Taeniopygia guttata 36.59 5.00e-45 174.00
IUUC-Tru-117960 Takifugu rubripes 37.72 5.00e-47 181.00
IUUC-Tsy-119069 Tarsius syrichta 37.26 3.00e-49 188.00
IUUC-Tni-120583 Tetraodon nigroviridis 38.03 1.00e-46 180.00
IUUC-Tca-121811 Theobroma cacao 32.32 1.00e-13 70.50
IUUC-Tre-122003 Trichoderma reesei 35.45 5.00e-18 84.30
IUUC-Tvi-122408 Trichoderma virens 28.65 3.00e-18 84.70
IUUC-Tae-123882 Triticum aestivum 25.32 4.00e-14 72.40
IUUC-Tur-126304 Triticum urartu 24.18 1.00e-17 84.00
IUUC-Tme-126880 Tuber melanosporum 27.80 1.00e-20 93.20
IUUC-Tbe-127583 Tupaia belangeri 37.23 3.00e-31 127.00
IUUC-Ttr-128717 Tursiops truncatus 39.84 1.00e-43 169.00
IUUC-Uma-129549 Ustilago maydis 28.29 3.00e-21 96.30
IUUC-Vda-129985 Verticillium dahliae 29.65 3.00e-19 88.60
IUUC-Vpa-130624 Vicugna pacos 34.94 2.00e-45 176.00
IUUC-Vvi-131541 Vitis vinifera 32.32 3.00e-16 79.30
IUUC-Xtr-131866 Xenopus tropicalis 34.92 7.00e-44 170.00
IUUC-Xma-134201 Xiphophorus maculatus 37.98 3.00e-48 185.00
IUUC-Yli-134583 Yarrowia lipolytica 26.03 5.00e-19 88.20
IUUC-Zma-135188 Zea mays 23.08 4.00e-16 79.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved