• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
UUCD2 ID IUUC-Sce-106150
Ensembl Protein ID YBL078C
UniProt Accession P38182; D6VPS5; ATG8_YEAST
Genbank Protein ID CAA56032.1; CAA84899.1; AAT92889.1; DAA07045.1
Protein Name Autophagy-related protein 8; Autophagy-related ubiquitin-like modifier ATG8; Cytoplasm to vacuole targeting protein 5
Genbank Nucleotide ID X79489; Z35839; AY692870; BK006936
Gene Name ATG8; APG8; AUT7; CVT5; YBL078C; YBL0732
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
YBL078C YBL078C YBL078C
Annotation
mRNA Expression
GEOFFGED
Protein-protein Interaction
IIDiRefIndexHINTMentha
Protein 3D Structure
PDBMMDB
Post-translational Modifications (PTMs)
dbPTM
Protein Expression/Proteomics
GPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
ULD/UBL/ATG8 ATG8 17632063
Classification
Family E-value Score Start End
ULD/UBL/ATG8 1.10e-50 168.6 13 116
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   ULD/UBL/ATG8

   S: 1    krkeevekirdkfpdkiPvivekakkekipeldkkkylvPsdltvgqlvkiirkrlqlraedalfllvnnslvsvsatlaeiyeeekdedgflyvayaseet 102
    krk+e+e+i+d+f+++iPvi+eka+k++ipe+dk+kylvP+dltvgq+v++irkr++l +e+a+f++vn++l++++a +++iy+e+kd+dgflyv+y++e+t
   Q: 13 KRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENT 114
    699*************************************************************************************************** PP
   S: 103 fG 104
    fG
   Q: 115 FG 116
    *9 PP
   

Organism Saccharomyces cerevisiae
Functional Description
(View)

Functional Description



     Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, mediates the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation is an important step required to facilitate multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Plays also a role in regulation of filamentous growth.
Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, mediates the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation is an important step required to facilitate multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Plays also a role in regulation of filamentous growth.
Protein Sequence
(Fasta)
MKSTFKSEYP FEKRKAESER IADRFKNRIP VICEKAEKSD IPEIDKRKYL VPADLTVGQF 60
VYVIRKRIML PPEKAIFIFV NDTLPPTAAL MSAIYQEHKD KDGFLYVTYS GENTFGR 117
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Sce-106150|ULD,ATG8|Saccharomyces cerevisiae
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGAAGTCTA CATTTAAGTC TGAATATCCA TTTGAAAAAA GGAAGGCGGA GTCGGAGAGG 60
ATTGCTGACA GGTTCAAGAA TAGGATACCT GTGATTTGCG AAAAAGCTGA AAAGTCAGAT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Sce-106150|ULD,ATG8|Saccharomyces cerevisiae
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0002--3D-structure
KW-0072--Autophagy
KW-0181--Complete proteome
KW-0968--Cytoplasmic vesicle
KW-0449--Lipoprotein
KW-0472--Membrane
KW-0653--Protein transport
KW-1185--Reference proteome
KW-0813--Transport
KW-0833--Ubl conjugation pathway
KW-0926--Vacuole

Interpro

IPR004241--Atg8-like
IPR029071--Ubiquitin-rel_dom

Pfam

PF02991--Atg8

Gene Ontology

GO:0005776--C:autophagosome
GO:0000421--C:autophagosome membrane
GO:0033110--C:Cvt vesicle membrane
GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0019898--C:extrinsic component of membrane
GO:0000329--C:fungal-type vacuole membrane
GO:0000407--C:pre-autophagosomal structure
GO:0031386--F:protein tag
GO:0000045--P:autophagosome assembly
GO:0006914--P:autophagy
GO:0034629--P:cellular protein complex localization
GO:0032258--P:CVT pathway
GO:0006888--P:ER to Golgi vesicle-mediated transport
GO:0044805--P:late nucleophagy
GO:0061025--P:membrane fusion
GO:0000422--P:mitophagy
GO:0034727--P:piecemeal microautophagy of nucleus
GO:0071211--P:protein targeting to vacuole involved in autophagy
GO:0061709--P:reticulophagy

KEGG sce:YBL078C
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000059 Aegilops tauschii 75.65 7.00e-51 189.00
IUUC-Aml-001629 Ailuropoda melanoleuca 56.03 1.00e-36 142.00
IUUC-Atr-002791 Amborella trichopoda 75.65 1.00e-49 186.00
IUUC-Apl-003994 Anas platyrhynchos 55.17 2.00e-36 142.00
IUUC-Aca-005288 Anolis carolinensis 56.03 1.00e-36 142.00
IUUC-Aly-005987 Arabidopsis lyrata 74.56 2.00e-49 185.00
IUUC-Ath-007243 Arabidopsis thaliana 73.04 2.00e-47 179.00
IUUC-Ago-007898 Ashbya gossypii 86.84 2.00e-57 211.00
IUUC-Acl-008314 Aspergillus clavatus 79.31 2.00e-52 195.00
IUUC-Afl-008708 Aspergillus flavus 79.31 1.00e-52 195.00
IUUC-Afu-009097 Aspergillus fumigatus 79.31 2.00e-52 195.00
IUUC-Ani-009196 Aspergillus nidulans 79.31 2.00e-52 194.00
IUUC-Ang-009530 Aspergillus niger 79.31 2.00e-52 195.00
IUUC-Aor-009909 Aspergillus oryzae 79.31 1.00e-52 195.00
IUUC-Ate-010358 Aspergillus terreus 79.31 2.00e-52 195.00
IUUC-Ame-010751 Astyanax mexicanus 56.03 4.00e-37 144.00
IUUC-Bgr-012248 Blumeria graminis 78.45 4.00e-52 194.00
IUUC-Bta-012520 Bos taurus 56.03 1.00e-36 142.00
IUUC-Bci-013959 Botrytis cinerea 77.59 4.00e-52 194.00
IUUC-Bdi-014929 Brachypodium distachyon 75.65 2.00e-50 188.00
IUUC-Bol-016488 Brassica oleracea 76.52 8.00e-49 183.00
IUUC-Bra-016921 Brassica rapa 75.44 4.00e-50 187.00
IUUC-Cel-018200 Caenorhabditis elegans 53.45 2.00e-34 135.00
IUUC-Cja-019273 Callithrix jacchus 56.90 4.00e-37 144.00
IUUC-Cfa-020373 Canis familiaris 56.03 1.00e-36 142.00
IUUC-Cpo-021831 Cavia porcellus 56.03 1.00e-36 142.00
IUUC-Cre-022866 Chlamydomonas reinhardtii 75.22 3.00e-43 164.00
IUUC-Csa-024201 Chlorocebus sabaeus 56.03 1.00e-36 142.00
IUUC-Cho-025008 Choloepus hoffmanni 51.28 4.00e-34 134.00
IUUC-Cin-025297 Ciona intestinalis 53.45 6.00e-36 140.00
IUUC-Csv-026146 Ciona savignyi 35.04 9.00e-19 83.60
IUUC-Cgl-026691 Colletotrichum gloeosporioides 57.50 8.00e-46 173.00
IUUC-Cne-026889 Cryptococcus neoformans 78.45 6.00e-52 193.00
IUUC-Cme-027158 Cyanidioschyzon merolae 31.25 4.00e-01 26.20
IUUC-Dre-028371 Danio rerio 55.17 4.00e-37 144.00
IUUC-Dno-029331 Dasypus novemcinctus 56.03 1.00e-36 142.00
IUUC-Dor-030453 Dipodomys ordii 56.03 1.00e-36 142.00
IUUC-Dse-031428 Dothistroma septosporum 79.31 1.00e-52 196.00
IUUC-Dme-031813 Drosophila melanogaster 56.03 3.00e-37 144.00
IUUC-Ete-032671 Echinops telfairi 55.17 9.00e-37 142.00
IUUC-Eca-034113 Equus caballus 56.03 2.00e-36 142.00
IUUC-Eeu-035131 Erinaceus europaeus 55.81 3.00e-26 107.00
IUUC-Fca-036385 Felis catus 56.03 1.00e-36 142.00
IUUC-Fal-036896 Ficedula albicollis 56.03 2.00e-36 142.00
IUUC-Fox-037846 Fusarium oxysporum 79.31 1.00e-52 196.00
IUUC-Fso-038134 Fusarium solani 79.31 1.00e-52 195.00
IUUC-Gmo-039289 Gadus morhua 56.03 9.00e-37 143.00
IUUC-Ggr-039770 Gaeumannomyces graminis 80.17 1.00e-52 196.00
IUUC-Gga-040257 Gallus gallus 56.90 1.00e-37 145.00
IUUC-Gac-041604 Gasterosteus aculeatus 56.90 8.00e-38 146.00
IUUC-Gma-044021 Glycine max 74.78 1.00e-49 186.00
IUUC-Ggo-044429 Gorilla gorilla 56.03 1.00e-36 142.00
IUUC-Hsa-046764 Homo sapiens 56.03 1.00e-36 142.00
IUUC-Hvu-047062 Hordeum vulgare 75.65 7.00e-51 189.00
IUUC-Itr-048405 Ictidomys tridecemlineatus 55.17 1.00e-36 142.00
IUUC-Kpa-049124 Komagataella pastoris 78.45 9.00e-52 192.00
IUUC-Lch-049542 Latimeria chalumnae 55.17 1.00e-36 142.00
IUUC-Lpe-051450 Leersia perrieri 76.52 2.00e-50 188.00
IUUC-Loc-052290 Lepisosteus oculatus 55.17 2.00e-36 142.00
IUUC-Laf-054203 Loxodonta africana 55.17 1.00e-36 142.00
IUUC-Mcc-055307 Macaca mulatta 55.17 1.00e-36 142.00
IUUC-Meu-056515 Macropus eugenii 56.03 1.00e-36 142.00
IUUC-Mor-057276 Magnaporthe oryzae 80.17 1.00e-52 196.00
IUUC-Mpo-057469 Magnaporthe poae 80.17 2.00e-52 194.00
IUUC-Mtr-057664 Medicago truncatula 73.91 1.00e-44 169.00
IUUC-Mla-059098 Melampsora laricipopulina 79.31 8.00e-53 196.00
IUUC-Mga-060108 Meleagris gallopavo 55.17 2.00e-36 141.00
IUUC-Mvi-060496 Microbotryum violaceum 79.13 3.00e-51 191.00
IUUC-Mmr-061776 Microcebus murinus 55.17 1.00e-36 142.00
IUUC-Mdo-061915 Monodelphis domestica 56.03 1.00e-36 142.00
IUUC-Mmu-064152 Mus musculus 56.03 1.00e-36 142.00
IUUC-Mac-064739 Musa acuminata 73.91 1.00e-43 166.00
IUUC-Mpu-066760 Mustela putorius furo 56.03 1.00e-36 142.00
IUUC-Mlu-068211 Myotis lucifugus 56.03 1.00e-36 142.00
IUUC-Nfi-068367 Neosartorya fischeri 79.31 2.00e-52 195.00
IUUC-Ncr-068894 Neurospora crassa 79.31 1.00e-52 196.00
IUUC-Nle-069755 Nomascus leucogenys 56.03 1.00e-36 142.00
IUUC-Opr-070777 Ochotona princeps 55.17 1.00e-36 142.00
IUUC-Ont-072343 Oreochromis niloticus 56.03 7.00e-37 143.00
IUUC-Oan-073485 Ornithorhynchus anatinus 58.10 4.00e-34 134.00
IUUC-Ocu-073861 Oryctolagus cuniculus 56.03 1.00e-36 142.00
IUUC-Oba-075722 Oryza barthii 74.78 1.00e-49 186.00
IUUC-Obr-076830 Oryza brachyantha 76.52 2.00e-50 188.00
IUUC-Ogl-077551 Oryza glaberrima 74.78 1.00e-49 186.00
IUUC-Ogu-078499 Oryza glumaepatula 74.78 1.00e-49 186.00
IUUC-Oin-079330 Oryza indica 73.04 1.00e-49 185.00
IUUC-Olo-080412 Oryza longistaminata 74.78 4.00e-49 184.00
IUUC-Ome-082013 Oryza meridionalis 73.04 1.00e-49 185.00
IUUC-Oni-082811 Oryza nivara 73.04 1.00e-49 185.00
IUUC-Opu-083501 Oryza punctata 76.52 2.00e-50 188.00
IUUC-Oru-084197 Oryza rufipogon 73.04 1.00e-49 185.00
IUUC-Osa-085654 Oryza sativa 73.04 1.00e-49 185.00
IUUC-Ola-086310 Oryzias latipes 56.90 6.00e-37 143.00
IUUC-Olu-087892 Ostreococcus lucimarinus 74.78 3.00e-49 184.00
IUUC-Oga-088483 Otolemur garnettii 56.03 1.00e-36 142.00
IUUC-Oar-089989 Ovis aries 55.17 1.00e-36 142.00
IUUC-Ptr-091560 Pan troglodytes 56.03 1.00e-36 142.00
IUUC-Pan-092269 Papio anubis 56.03 1.00e-36 142.00
IUUC-Psi-093055 Pelodiscus sinensis 54.70 1.00e-36 142.00
IUUC-Pma-094337 Petromyzon marinus 55.56 7.00e-39 150.00
IUUC-Pno-095035 Phaeosphaeria nodorum 79.31 1.00e-52 196.00
IUUC-Ppa-095787 Physcomitrella patens 76.52 2.00e-49 185.00
IUUC-Pfo-096380 Poecilia formosa 56.03 8.00e-37 143.00
IUUC-Pab-098563 Pongo abelii 56.03 1.00e-36 142.00
IUUC-Pop-098791 Populus trichocarpa 74.78 1.00e-49 185.00
IUUC-Pca-100230 Procavia capensis 55.17 1.00e-36 142.00
IUUC-Ppe-101457 Prunus persica 73.04 1.00e-43 166.00
IUUC-Pva-103103 Pteropus vampyrus 54.70 1.00e-36 142.00
IUUC-Pte-104230 Pyrenophora teres 79.31 1.00e-52 196.00
IUUC-Rno-105111 Rattus norvegicus 56.03 1.00e-36 142.00
IUUC-Sha-106656 Sarcophilus harrisii 55.17 1.00e-36 142.00
IUUC-Sja-107857 Schizosaccharomyces japonicus 74.36 1.00e-49 186.00
IUUC-Spo-108156 Schizosaccharomyces pombe 73.28 4.00e-42 160.00
IUUC-Ssl-108578 Sclerotinia sclerotiorum 77.59 4.00e-52 194.00
IUUC-Smo-109082 Selaginella moellendorffii 77.39 1.00e-49 186.00
IUUC-Sit-110531 Setaria italica 75.44 3.00e-49 184.00
IUUC-Sly-111488 Solanum lycopersicum 74.78 3.00e-44 167.00
IUUC-Stu-112559 Solanum tuberosum 74.78 3.00e-44 167.00
IUUC-Sar-113670 Sorex araneus 50.00 3.00e-32 128.00
IUUC-Sbi-114346 Sorghum bicolor 74.78 4.00e-49 184.00
IUUC-Sre-114964 Sporisorium reilianum 76.72 3.00e-51 191.00
IUUC-Ssc-115828 Sus scrofa 56.03 1.00e-36 142.00
IUUC-Tgu-117195 Taeniopygia guttata 56.03 1.00e-36 142.00
IUUC-Tru-118632 Takifugu rubripes 55.17 1.00e-36 143.00
IUUC-Tsy-118919 Tarsius syrichta 54.70 1.00e-36 142.00
IUUC-Tni-120706 Tetraodon nigroviridis 56.03 2.00e-36 142.00
IUUC-Tca-121335 Theobroma cacao 73.04 1.00e-43 167.00
IUUC-Tre-122077 Trichoderma reesei 79.31 1.00e-52 196.00
IUUC-Tvi-122400 Trichoderma virens 79.31 1.00e-52 196.00
IUUC-Tae-122697 Triticum aestivum 75.65 4.00e-50 188.00
IUUC-Tur-126158 Triticum urartu 75.65 1.00e-50 188.00
IUUC-Tme-126955 Tuber melanosporum 78.45 4.00e-51 191.00
IUUC-Tbe-127765 Tupaia belangeri 62.79 3.00e-30 120.00
IUUC-Ttr-128205 Tursiops truncatus 56.03 1.00e-36 142.00
IUUC-Uma-129435 Ustilago maydis 76.07 2.00e-51 191.00
IUUC-Vda-129807 Verticillium dahliae 79.31 1.00e-52 196.00
IUUC-Vpa-130804 Vicugna pacos 56.03 9.00e-37 142.00
IUUC-Vvi-130830 Vitis vinifera 73.91 3.00e-43 164.00
IUUC-Xtr-132685 Xenopus tropicalis 56.03 8.00e-37 143.00
IUUC-Xma-133675 Xiphophorus maculatus 56.03 8.00e-37 143.00
IUUC-Yli-134327 Yarrowia lipolytica 78.45 4.00e-46 174.00
IUUC-Zma-135270 Zea mays 75.65 1.00e-49 186.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved