• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • Mentha
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
UUCD2 ID IUUC-Rno-105927
UUCD1 version UUC-RaN-00973
Ensembl Protein ID ENSRNOP00000071283.1
UniProt Accession Q9EQX9; UBE2N_RAT
Genbank Protein ID BAB20414.1; AAH90072.1
Protein Name Ubiquitin-conjugating enzyme E2 N; Bendless-like ubiquitin-conjugating enzyme; E2 ubiquitin-conjugating enzyme N; Ubiquitin carrier protein N; Ubiquitin-protein ligase N
Genbank Nucleotide ID AB032739; BC090072
Gene Name Ube2n
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSRNOG00000058053.1 ENSRNOT00000089874.1 ENSRNOP00000071283.1
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEO
DNA & RNA Element
microRNATRANSFACRAID2
Protein-protein Interaction
IIDMentha
Post-translational Modifications (PTMs)
CPLMdbPAFPhosphositePlusUniProt
Protein Expression/Proteomics
GPMDB
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.30e-47 161.4 7 139
Active Site
Position(s) Description Evidence
87 Glycyl thioester intermediate N/A
Domain Profile

   E2/UBC

   S: 1    RlkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilkee 89
    R+ ke+++l ++p++gi+a+p+++ + ++v+i Gp+d+p+egg+Fkle+ +pe+YP+ +Pkv+f+tki+hPnv++ G++Cl+ilk
   Q: 7 RIIKETQRLLAEPVPGIKAEPDES-NARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILK-- 92
    899*********************.9************************************************************9.. PP
   S: 90 ekWspalsvesvllsiqsllaepnpesplneeaaellkknreeykkk 136
    +kWspal++++vllsiq+ll+ pnp++pl +++ae++k+n+++ ++
   Q: 93 DKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKSNEAQAIET 139
    ****************************************9976655 PP
   

Organism Rattus norvegicus
Functional Description
(View)

Functional Description



     The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes.
The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes.
Protein Sequence
(Fasta)
MAGLPRRIIK ETQRLLAEPV PGIKAEPDES NARYFHVVIA GPQDSPFEGG TFKLELFLPE 60
EYPMAAPKVR FMTKIYHPNV DKLGRICLDI LKDKWSPALQ IRTVLLSIQA LLSAPNPDDP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Rno-105927|E2,E2/UBC|Rattus norvegicus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTCTGGACGC CCAGTTGCGC GAATTCTGCC GCGGGCGAAG AAGCTCGGCG CCGCCTCGCG 60
CCGCCTCCCC CAAAGTCCCT GCCCCGCCGC GGAGCGTCAC TTCCGCCACC CCGGGCTGGG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Rno-105927|E2,E2/UBC|Rattus norvegicus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0007--Acetylation
KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0903--Direct protein sequencing
KW-0227--DNA damage
KW-0234--DNA repair
KW-1017--Isopeptide bond
KW-0547--Nucleotide-binding
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0808--Transferase
KW-0832--Ubl conjugation
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005634--C:nucleus
GO:0035370--C:UBC13-UEV1A complex
GO:0000151--C:ubiquitin ligase complex
GO:0005524--F:ATP binding
GO:0061631--F:ubiquitin conjugating enzyme activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0004842--F:ubiquitin-protein transferase activity
GO:0006301--P:postreplication repair
GO:0070534--P:protein K63-linked ubiquitination
GO:0016567--P:protein ubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG rno:116725
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000100 Aegilops tauschii 79.59 2.00e-69 253.00
IUUC-Aml-001889 Ailuropoda melanoleuca 96.55 1.00e-80 291.00
IUUC-Atr-002818 Amborella trichopoda 79.59 6.00e-70 255.00
IUUC-Apl-003469 Anas platyrhynchos 97.26 7.00e-83 298.00
IUUC-Aca-005051 Anolis carolinensis 99.34 4.00e-87 312.00
IUUC-Aly-006258 Arabidopsis lyrata 80.95 1.00e-70 258.00
IUUC-Ath-007639 Arabidopsis thaliana 80.27 3.00e-70 256.00
IUUC-Ago-007837 Ashbya gossypii 75.20 2.00e-54 204.00
IUUC-Acl-008263 Aspergillus clavatus 71.62 8.00e-64 235.00
IUUC-Afl-008733 Aspergillus flavus 72.30 6.00e-64 236.00
IUUC-Afu-008946 Aspergillus fumigatus 71.62 8.00e-64 235.00
IUUC-Ani-009482 Aspergillus nidulans 71.33 3.00e-64 236.00
IUUC-Ang-009678 Aspergillus niger 72.30 1.00e-63 235.00
IUUC-Aor-010025 Aspergillus oryzae 72.30 6.00e-64 236.00
IUUC-Ate-010254 Aspergillus terreus 71.23 1.00e-62 231.00
IUUC-Ame-010742 Astyanax mexicanus 97.37 3.00e-85 306.00
IUUC-Bgr-012156 Blumeria graminis 65.56 2.00e-54 204.00
IUUC-Bta-012636 Bos taurus 99.34 4.00e-87 312.00
IUUC-Bci-013761 Botrytis cinerea 72.48 4.00e-63 233.00
IUUC-Bdi-014796 Brachypodium distachyon 80.95 1.00e-70 258.00
IUUC-Bol-016613 Brassica oleracea 80.95 1.00e-70 258.00
IUUC-Bra-016938 Brassica rapa 80.95 1.00e-70 258.00
IUUC-Cel-018119 Caenorhabditis elegans 87.92 1.00e-74 271.00
IUUC-Cja-019108 Callithrix jacchus 99.34 4.00e-87 312.00
IUUC-Cfa-020561 Canis familiaris 98.68 2.00e-86 310.00
IUUC-Cpo-022280 Cavia porcellus 96.03 3.00e-83 300.00
IUUC-Cre-022978 Chlamydomonas reinhardtii 78.91 4.00e-67 246.00
IUUC-Csa-023860 Chlorocebus sabaeus 92.11 5.00e-80 289.00
IUUC-Cho-024459 Choloepus hoffmanni 99.34 4.00e-87 312.00
IUUC-Cin-025278 Ciona intestinalis 80.27 7.00e-69 252.00
IUUC-Csv-025952 Ciona savignyi 72.97 2.00e-60 224.00
IUUC-Cgl-026752 Colletotrichum gloeosporioides 71.43 2.00e-61 227.00
IUUC-Cne-026809 Cryptococcus neoformans 74.44 5.00e-57 212.00
IUUC-Cme-027100 Cyanidioschyzon merolae 65.77 1.00e-56 211.00
IUUC-Dre-027931 Danio rerio 98.03 2.00e-85 307.00
IUUC-Dno-030059 Dasypus novemcinctus 98.03 9.00e-86 308.00
IUUC-Dor-030269 Dipodomys ordii 99.22 5.00e-73 265.00
IUUC-Dse-031505 Dothistroma septosporum 68.03 9.00e-60 221.00
IUUC-Dme-032097 Drosophila melanogaster 80.13 2.00e-72 263.00
IUUC-Ete-032369 Echinops telfairi 99.34 4.00e-87 312.00
IUUC-Eca-033230 Equus caballus 99.34 4.00e-87 312.00
IUUC-Fca-036161 Felis catus 94.74 6.00e-83 298.00
IUUC-Fal-036781 Ficedula albicollis 96.05 2.00e-84 303.00
IUUC-Fox-037840 Fusarium oxysporum 71.92 8.00e-61 225.00
IUUC-Fso-038118 Fusarium solani 71.92 5.00e-61 226.00
IUUC-Gmo-039561 Gadus morhua 92.76 2.00e-82 297.00
IUUC-Ggr-039807 Gaeumannomyces graminis 72.79 1.00e-62 231.00
IUUC-Gga-041024 Gallus gallus 99.34 4.00e-87 312.00
IUUC-Gac-042450 Gasterosteus aculeatus 92.72 3.00e-81 293.00
IUUC-Gma-043982 Glycine max 80.95 1.00e-70 258.00
IUUC-Ggo-044660 Gorilla gorilla 98.68 2.00e-86 310.00
IUUC-Hsa-045881 Homo sapiens 99.34 4.00e-87 312.00
IUUC-Hvu-047346 Hordeum vulgare 80.95 1.00e-70 258.00
IUUC-Itr-048350 Ictidomys tridecemlineatus 91.45 3.00e-78 283.00
IUUC-Kpa-049285 Komagataella pastoris 70.27 6.00e-63 232.00
IUUC-Lch-050548 Latimeria chalumnae 94.41 3.00e-79 286.00
IUUC-Lpe-051394 Leersia perrieri 80.27 2.00e-70 257.00
IUUC-Loc-052205 Lepisosteus oculatus 97.37 3.00e-85 307.00
IUUC-Lma-053056 Leptosphaeria maculans 72.60 1.00e-62 231.00
IUUC-Laf-053540 Loxodonta africana 99.30 3.00e-81 293.00
IUUC-Mcc-054863 Macaca mulatta 99.34 4.00e-87 312.00
IUUC-Meu-056482 Macropus eugenii 99.30 3.00e-81 293.00
IUUC-Mor-057014 Magnaporthe oryzae 72.60 3.00e-61 226.00
IUUC-Mpo-057586 Magnaporthe poae 72.79 1.00e-62 231.00
IUUC-Mtr-058552 Medicago truncatula 72.67 8.00e-67 245.00
IUUC-Mla-058920 Melampsora laricipopulina 69.39 1.00e-60 225.00
IUUC-Mga-059649 Meleagris gallopavo 95.97 4.00e-82 296.00
IUUC-Mvi-060483 Microbotryum violaceum 75.51 4.00e-65 239.00
IUUC-Mmr-061167 Microcebus murinus 99.34 4.00e-87 312.00
IUUC-Mdo-062701 Monodelphis domestica 99.34 4.00e-87 312.00
IUUC-Mmu-064070 Mus musculus 99.34 4.00e-87 312.00
IUUC-Mac-064742 Musa acuminata 80.27 1.00e-70 258.00
IUUC-Mpu-066401 Mustela putorius furo 99.34 5.00e-87 312.00
IUUC-Mlu-067229 Myotis lucifugus 97.96 1.00e-82 297.00
IUUC-Nfi-068526 Neosartorya fischeri 71.62 9.00e-64 235.00
IUUC-Ncr-068643 Neurospora crassa 72.11 3.00e-62 230.00
IUUC-Nle-070146 Nomascus leucogenys 99.34 4.00e-87 312.00
IUUC-Opr-070232 Ochotona princeps 77.63 4.00e-63 233.00
IUUC-Ont-072369 Oreochromis niloticus 94.00 4.00e-82 296.00
IUUC-Oan-073174 Ornithorhynchus anatinus 95.39 3.00e-83 300.00
IUUC-Ocu-074712 Oryctolagus cuniculus 99.34 4.00e-87 312.00
IUUC-Oba-075408 Oryza barthii 80.27 2.00e-70 257.00
IUUC-Obr-076881 Oryza brachyantha 80.27 2.00e-70 257.00
IUUC-Ogl-077242 Oryza glaberrima 80.27 2.00e-70 257.00
IUUC-Ogu-078465 Oryza glumaepatula 80.27 2.00e-70 257.00
IUUC-Oin-080035 Oryza indica 80.43 4.00e-66 243.00
IUUC-Olo-080555 Oryza longistaminata 80.27 2.00e-70 257.00
IUUC-Ome-081653 Oryza meridionalis 80.27 2.00e-70 257.00
IUUC-Oni-082400 Oryza nivara 80.27 2.00e-70 257.00
IUUC-Opu-083130 Oryza punctata 80.43 2.00e-65 241.00
IUUC-Oru-084649 Oryza rufipogon 80.27 2.00e-70 257.00
IUUC-Osa-085629 Oryza sativa 80.27 2.00e-70 257.00
IUUC-Ola-087083 Oryzias latipes 95.33 2.00e-82 297.00
IUUC-Olu-087886 Ostreococcus lucimarinus 67.35 3.00e-58 216.00
IUUC-Oga-088983 Otolemur garnettii 95.33 1.00e-82 298.00
IUUC-Oar-090440 Ovis aries 98.68 2.00e-86 310.00
IUUC-Ptr-090572 Pan troglodytes 99.34 4.00e-87 312.00
IUUC-Pan-092503 Papio anubis 97.37 2.00e-85 307.00
IUUC-Psi-093419 Pelodiscus sinensis 99.26 9.00e-78 281.00
IUUC-Pma-094136 Petromyzon marinus 92.86 3.00e-43 165.00
IUUC-Pno-094838 Phaeosphaeria nodorum 72.30 2.00e-63 234.00
IUUC-Ppa-095892 Physcomitrella patens 81.63 2.00e-70 257.00
IUUC-Pfo-096074 Poecilia formosa 96.00 5.00e-83 299.00
IUUC-Pab-097778 Pongo abelii 99.34 4.00e-87 312.00
IUUC-Pop-099707 Populus trichocarpa 79.59 7.00e-70 255.00
IUUC-Pca-100334 Procavia capensis 82.89 1.00e-72 264.00
IUUC-Ppe-101149 Prunus persica 80.95 1.00e-70 258.00
IUUC-Pva-102979 Pteropus vampyrus 99.34 4.00e-87 312.00
IUUC-Pgr-103654 Puccinia graminis 71.43 8.00e-61 225.00
IUUC-Ptt-103752 Puccinia triticina 70.14 2.00e-58 217.00
IUUC-Pte-104137 Pyrenophora teres 71.23 9.00e-62 228.00
IUUC-Pyt-104513 Pyrenophora triticirepentis 71.23 9.00e-62 228.00
IUUC-Sce-106178 Saccharomyces cerevisiae 70.27 1.00e-61 228.00
IUUC-Sha-107493 Sarcophilus harrisii 99.34 4.00e-87 312.00
IUUC-Sja-107878 Schizosaccharomyces japonicus 66.89 8.00e-58 216.00
IUUC-Spo-108062 Schizosaccharomyces pombe 68.71 6.00e-57 212.00
IUUC-Ssl-108395 Sclerotinia sclerotiorum 70.95 2.00e-61 227.00
IUUC-Smo-109587 Selaginella moellendorffii 74.00 2.00e-63 234.00
IUUC-Sit-110151 Setaria italica 80.95 2.00e-70 258.00
IUUC-Sly-111322 Solanum lycopersicum 80.95 1.00e-70 258.00
IUUC-Stu-112722 Solanum tuberosum 80.27 4.00e-70 256.00
IUUC-Sar-113464 Sorex araneus 99.30 3.00e-81 293.00
IUUC-Sbi-114864 Sorghum bicolor 80.27 7.00e-70 255.00
IUUC-Sre-114927 Sporisorium reilianum 78.08 7.00e-67 245.00
IUUC-Ssc-116096 Sus scrofa 99.34 4.00e-87 312.00
IUUC-Tgu-117266 Taeniopygia guttata 99.30 3.00e-81 293.00
IUUC-Tru-117903 Takifugu rubripes 94.04 8.00e-82 295.00
IUUC-Tsy-118952 Tarsius syrichta 99.30 3.00e-81 293.00
IUUC-Tni-120038 Tetraodon nigroviridis 94.04 8.00e-82 295.00
IUUC-Tca-121752 Theobroma cacao 79.86 2.00e-65 241.00
IUUC-Tre-121979 Trichoderma reesei 73.97 3.00e-62 230.00
IUUC-Tvi-122515 Trichoderma virens 73.29 2.00e-61 228.00
IUUC-Tae-125309 Triticum aestivum 80.95 1.00e-70 258.00
IUUC-Tur-126687 Triticum urartu 78.72 3.00e-65 240.00
IUUC-Tme-127129 Tuber melanosporum 73.97 4.00e-63 233.00
IUUC-Tbe-127846 Tupaia belangeri 99.30 3.00e-81 293.00
IUUC-Ttr-128808 Tursiops truncatus 97.37 3.00e-84 303.00
IUUC-Uma-129548 Ustilago maydis 78.77 2.00e-67 247.00
IUUC-Vda-129810 Verticillium dahliae 71.23 8.00e-61 225.00
IUUC-Vpa-130221 Vicugna pacos 90.65 7.00e-69 251.00
IUUC-Vvi-131416 Vitis vinifera 66.85 7.00e-66 242.00
IUUC-Xtr-132366 Xenopus tropicalis 96.10 3.00e-84 303.00
IUUC-Xma-132986 Xiphophorus maculatus 95.33 1.00e-82 297.00
IUUC-Yli-134605 Yarrowia lipolytica 72.97 1.00e-63 235.00
IUUC-Zma-135587 Zea mays 77.12 3.00e-68 250.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved